KEGG   Homo sapiens (human): 1999Help
Entry
1999              CDS       T01001                                 

Gene name
ELF3, EPR-1, ERT, ESE-1, ESX
Definition
(RefSeq) E74 like ETS transcription factor 3
  KO
K09429  E74-like factor 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1999 (ELF3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    1999 (ELF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT AT_hook
Motif
Other DBs
NCBI-GeneID: 1999
NCBI-ProteinID: NP_001107781
OMIM: 602191
HGNC: 3318
Ensembl: ENSG00000163435
Vega: OTTHUMG00000035867
Pharos: P78545(Tbio)
UniProt: P78545 A0A024R974
Structure
PDB: 

Position
1q32.1
AA seq 371 aa AA seqDB search
MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWL
GEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQ
LHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYH
PGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDP
KHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHE
GVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSG
WKEEEVLQSRN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacctgtgagattagcaacatttttagcaactacttcagtgcgatgtacagc
tcggaggactccaccctggcctctgttccccctgctgccacctttggggccgatgacttg
gtactgaccctgagcaacccccagatgtcattggagggtacagagaaggccagctggttg
ggggaacagccccagttctggtcgaagacgcaggttctggactggatcagctaccaagtg
gagaagaacaagtacgacgcaagcgccattgacttctcacgatgtgacatggatggcgcc
accctctgcaattgtgcccttgaggagctgcgtctggtctttgggcctctgggggaccaa
ctccatgcccagctgcgagacctcacttccagctcttctgatgagctcagttggatcatt
gagctgctggagaaggatggcatggccttccaggaggccctagacccagggccctttgac
cagggcagcccctttgcccaggagctgctggacgacggtcagcaagccagcccctaccac
cccggcagctgtggcgcaggagccccctcccctggcagctctgacgtctccaccgcaggg
actggtgcttctcggagctcccactcctcagactccggtggaagtgacgtggacctggat
cccactgatggcaagctcttccccagcgatggttttcgtgactgcaagaagggggatccc
aagcacgggaagcggaaacgaggccggccccgaaagctgagcaaagagtactgggactgt
ctcgagggcaagaagagcaagcacgcgcccagaggcacccacctgtgggagttcatccgg
gacatcctcatccacccggagctcaacgagggcctcatgaagtgggagaatcggcatgaa
ggcgtcttcaagttcctgcgctccgaggctgtggcccaactatggggccaaaagaaaaag
aacagcaacatgacctacgagaagctgagccgggccatgaggtactactacaaacgggag
atcctggaacgggtggatggccggcgactcgtctacaagtttggcaaaaactcaagcggc
tggaaggaggaagaggttctccagagtcggaactga

DBGET integrated database retrieval system