KEGG   Homo sapiens (human): 199964
Entry
199964            CDS       T01001                                 
Symbol
TMEM61
Name
(RefSeq) transmembrane protein 61
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: TMEM61 Mtp
Other DBs
NCBI-GeneID: 199964
NCBI-ProteinID: NP_872338
HGNC: 27296
Ensembl: ENSG00000143001
UniProt: Q8N0U2
Position
1:54980628..54992288
AA seq 210 aa
MALPQMCDGSHLASTLRYCMTVSGTVVLVAGTLCFAWWSEGDATAQPGQLAPPTEYPVPE
GPSPLLRSVSFVCCGAGGLLLLIGLLWSVKASIPGPPRWDPYHLSRDLYYLTVESSEKES
CRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESI
SLALDAVSAETTPSATRSCSGLVQTARGGS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggccctgccccagatgtgtgacgggagccacttggcctccaccctccgctattgcatg
acagtcagcggcacagtggttctggtggccgggacgctctgcttcgcttggtggagcgaa
ggggatgcaaccgcccagcctggccagctggccccacccacggagtatccggtgcctgag
ggccccagccccctgctcaggtccgtcagcttcgtctgctgcggtgcaggtggcctgctg
ctgctcattggcctgctgtggtccgtcaaggccagcatcccagggccacctcgatgggac
ccctatcacctctccagagacctgtactacctcactgtggagtcctcagagaaggagagc
tgcaggacccccaaagtggttgacatccccacttacgaggaagccgtgagcttcccagtg
gccgaggggcccccaacaccacctgcataccctacggaggaagccctggagccaagtgga
tcgagggatgccctgctcagcacccagcccgcctggcctccacccagctatgagagcatc
agccttgctcttgatgccgtttctgcggagacgacaccgagtgccacacgctcctgctca
ggcctggttcagactgcacggggaggaagttaa

DBGET integrated database retrieval system