KEGG   Homo sapiens (human): 2Help
Entry
2                 CDS       T01001                                 

Gene name
A2M, A2MD, CPAMD5, FWP007, S863-7
Definition
(RefSeq) alpha-2-macroglobulin
  KO
K03910  alpha-2-macroglobulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2 (A2M)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    2 (A2M)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   2 (A2M)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: A2M_comp A2M_N_2 A2M A2M_recep A2M_N Thiol-ester_cl SVA MP
Motif
Other DBs
NCBI-GeneID: 2
NCBI-ProteinID: NP_000005
OMIM: 103950
HGNC: 7
Ensembl: ENSG00000175899
Vega: OTTHUMG00000150267
Pharos: P01023(Tbio)
UniProt: P01023
Structure
PDB: 

Position
12p13.31
AA seq 1474 aa AA seqDB search
MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTV
SASLESVRGNRSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTV
MVKNEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQS
FQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEEFVLPKFEVQVTVPKIIT
ILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCF
YQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVELTGRQSSEITRTITKLSFVKVDSHFR
QGIPFFGQVRLVDGKGVPIPNKVIFIRGNEANYYSNATTDEHGLVQFSINTTNVMGTSLT
VRVNYKDRSPCYGYQWVSEEHEEAHHTAYLVFSPSKSFVHLEPMSHELPCGHTQTVQAHY
ILNGGTLLGLKKLSFYYLIMAKGGIVRTGTHGLLVKQEDMKGHFSISIPVKSDIAPVARL
LIYAVLPTGDVIGDSAKYDVENCLANKVDLSFSPSQSLPASHAHLRVTAAPQSVCALRAV
DQSVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSS
TNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARL
VHVEEPHTETVRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGI
SSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVE
KEQAPHCICANGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVPSVPEHGRKDTVI
KPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQ
NTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKH
YDGSYSTFGERYGRNQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCF
RSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVTHPVVRNALFCLESAWKTAQEGDH
GSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQ
APSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHA
LSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEYSMKVTGEG
CVYLQTSLKYNILPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAI
VDVKMVSGFIPLKPTVKMLERSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
DLKPAIVKVYDYYETDEFAIAEYNAPCSKDLGNA
NT seq 4425 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaacaaactccttcatccaagtctggttcttctcctcttggtcctcctgccc
acagacgcctcagtctctggaaaaccgcagtatatggttctggtcccctccctgctccac
actgagaccactgagaagggctgtgtccttctgagctacctgaatgagacagtgactgta
agtgcttccttggagtctgtcaggggaaacaggagcctcttcactgacctggaggcggag
aatgacgtactccactgtgtcgccttcgctgtcccaaagtcttcatccaatgaggaggta
atgttcctcactgtccaagtgaaaggaccaacccaagaatttaagaagcggaccacagtg
atggttaagaacgaggacagtctggtctttgtccagacagacaaatcaatctacaaacca
gggcagacagtgaaatttcgtgttgtctccatggatgaaaactttcaccccctgaatgag
ttgattccactagtatacattcaggatcccaaaggaaatcgcatcgcacaatggcagagt
ttccagttagagggtggcctcaagcaattttcttttcccctctcatcagagcccttccag
ggctcctacaaggtggtggtacagaagaaatcaggtggaaggacagagcaccctttcacc
gtggaggaatttgttcttcccaagtttgaagtacaagtaacagtgccaaagataatcacc
atcttggaagaagagatgaatgtatcagtgtgtggcctatacacatatgggaagcctgtc
cctggacatgtgactgtgagcatttgcagaaagtatagtgacgcttccgactgccacggt
gaagattcacaggctttctgtgagaaattcagtggacagctaaacagccatggctgcttc
tatcagcaagtaaaaaccaaggtcttccagctgaagaggaaggagtatgaaatgaaactt
cacactgaggcccagatccaagaagaaggaacagtggtggaattgactggaaggcagtcc
agtgaaatcacaagaaccataaccaaactctcatttgtgaaagtggactcacactttcga
cagggaattcccttctttgggcaggtgcgcctagtagatgggaaaggcgtccctatacca
aataaagtcatattcatcagaggaaatgaagcaaactattactccaatgctaccacggat
gagcatggccttgtacagttctctatcaacaccaccaatgttatgggtacctctcttact
gttagggtcaattacaaggatcgtagtccctgttacggctaccagtgggtgtcagaagaa
cacgaagaggcacatcacactgcttatcttgtgttctccccaagcaagagctttgtccac
cttgagcccatgtctcatgaactaccctgtggccatactcagacagtccaggcacattat
attctgaatggaggcaccctgctggggctgaagaagctctccttctattatctgataatg
gcaaagggaggcattgtccgaactgggactcatggactgcttgtgaagcaggaagacatg
aagggccatttttccatctcaatccctgtgaagtcagacattgctcctgtcgctcggttg
ctcatctatgctgttttacctaccggggacgtgattggggattctgcaaaatatgatgtt
gaaaattgtctggccaacaaggtggatttgagcttcagcccatcacaaagtctcccagcc
tcacacgcccacctgcgagtcacagcggctcctcagtccgtctgcgccctccgtgctgtg
gaccaaagcgtgctgctcatgaagcctgatgctgagctctcggcgtcctcggtttacaac
ctgctaccagaaaaggacctcactggcttccctgggcctttgaatgaccaggacgatgaa
gactgcatcaatcgtcataatgtctatattaatggaatcacatatactccagtatcaagt
acaaatgaaaaggatatgtacagcttcctagaggacatgggcttaaaggcattcaccaac
tcaaagattcgtaaacccaaaatgtgtccacagcttcaacagtatgaaatgcatggacct
gaaggtctacgtgtaggtttttatgagtcagatgtaatgggaagaggccatgcacgcctg
gtgcatgttgaagagcctcacacggagaccgtacgaaagtacttccctgagacatggatc
tgggatttggtggtggtaaactcagcaggtgtggctgaggtaggagtaacagtccctgac
accatcaccgagtggaaggcaggggccttctgcctgtctgaagatgctggacttggtatc
tcttccactgcctctctccgagccttccagcccttctttgtggagctcacaatgccttac
tctgtgattcgtggagaggccttcacactcaaggccacggtcctaaactaccttcccaaa
tgcatccgggtcagtgtgcagctggaagcctctcccgccttcctagctgtcccagtggag
aaggaacaagcgcctcactgcatctgtgcaaacgggcggcaaactgtgtcctgggcagta
accccaaagtcattaggaaatgtgaatttcactgtgagcgcagaggcactagagtctcaa
gagctgtgtgggactgaggtgccttcagttcctgaacacggaaggaaagacacagtcatc
aagcctctgttggttgaacctgaaggactagagaaggaaacaacattcaactccctactt
tgtccatcaggtggtgaggtttctgaagaattatccctgaaactgccaccaaatgtggta
gaagaatctgcccgagcttctgtctcagttttgggagacatattaggctctgccatgcaa
aacacacaaaatcttctccagatgccctatggctgtggagagcagaatatggtcctcttt
gctcctaacatctatgtactggattatctaaatgaaacacagcagcttactccagagatc
aagtccaaggccattggctatctcaacactggttaccagagacagttgaactacaaacac
tatgatggctcctacagcacctttggggagcgatatggcaggaaccagggcaacacctgg
ctcacagcctttgttctgaagacttttgcccaagctcgagcctacatcttcatcgatgaa
gcacacattacccaagccctcatatggctctcccagaggcagaaggacaatggctgtttc
aggagctctgggtcactgctcaacaatgccataaagggaggagtagaagatgaagtgacc
ctctccgcctatatcaccatcgcccttctggagattcctctcacagtcactcaccctgtt
gtccgcaatgccctgttttgcctggagtcagcctggaagacagcacaagaaggggaccat
ggcagccatgtatataccaaagcactgctggcctatgcttttgccctggcaggtaaccag
gacaagaggaaggaagtactcaagtcacttaatgaggaagctgtgaagaaagacaactct
gtccattgggagcgccctcagaaacccaaggcaccagtggggcatttttacgaaccccag
gctccctctgctgaggtggagatgacatcctatgtgctcctcgcttatctcacggcccag
ccagccccaacctcggaggacctgacctctgcaaccaacatcgtgaagtggatcacgaag
cagcagaatgcccagggcggtttctcctccacccaggacacagtggtggctctccatgct
ctgtccaaatatggagcagccacatttaccaggactgggaaggctgcacaggtgactatc
cagtcttcagggacattttccagcaaattccaagtggacaacaacaaccgcctgttactg
cagcaggtctcattgccagagctgcctggggaatacagcatgaaagtgacaggagaagga
tgtgtctacctccagacatccttgaaatacaatattctcccagaaaaggaagagttcccc
tttgctttaggagtgcagactctgcctcaaacttgtgatgaacccaaagcccacaccagc
ttccaaatctccctaagtgtcagttacacagggagccgctctgcctccaacatggcgatc
gttgatgtgaagatggtctctggcttcattcccctgaagccaacagtgaaaatgcttgaa
agatctaaccatgtgagccggacagaagtcagcagcaaccatgtcttgatttaccttgat
aaggtgtcaaatcagacactgagcttgttcttcacggttctgcaagatgtcccagtaaga
gatctgaaaccagccatagtgaaagtctatgattactacgagacggatgagtttgcaatt
gctgagtacaatgctccttgcagcaaagatcttggaaatgcttga

DBGET integrated database retrieval system