KEGG   Homo sapiens (human): 200081Help
Entry
200081            CDS       T01001                                 

Gene name
TXLNA, IL14, TXLN
Definition
(RefSeq) taxilin alpha
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Taxilin KELK FlaC_arch
Motif
Other DBs
NCBI-GeneID: 200081
NCBI-ProteinID: NP_787048
OMIM: 608676
HGNC: 30685
Ensembl: ENSG00000084652
Vega: OTTHUMG00000004423
Pharos: P40222(Tbio)
UniProt: P40222
Position
1p35.2
AA seq 546 aa AA seqDB search
MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQA
RTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARN
GEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKKKAKGLGKEITLLMQTLN
TLSTPEEKLAALCKKYAELLEEHRNSQKQMKLLQKKQSQLVQEKDHLRGEHSKAVLARSK
LESLCRELQRHNRSLKEEGVQRAREEEEKRKEVTSHFQVTLNDIQLQMEQHNERNSKLRQ
ENMELAERLKKLIEQYELREEHIDKVFKHKDLQQQLVDAKLQQAQEMLKEAEERHQREKD
FLLKEAVESQRMCELMKQQETHLKQQLALYTEKFEEFQNTLSKSSEVFTTFKQEMEKMTK
KIKKLEKETTMYRSRWESSNKALLEMAEEKTVRDKELEGLQVKIQRLEKLCRALQTERND
LNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQE
PTSARA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccaagacaaaaagaacggggctgccaaacaatccaatccaaaaagcagccca
ggacaaccggaagcaggacccgagggagcccaggagcggcccagccaggcggctcctgca
gtagaagcagaaggtcccggcagcagccaggctcctcggaagccggagggggctcaagcc
agaacggctcagtctggggcccttcgtgatgtctctgaggagctgagccgccaactggaa
gacatactgagcacatactgtgtggacaataaccaggggggccccggcgaggatggggca
cagggtgagccggctgaacccgaagatgcagagaagtcccggacctatgtggcaaggaat
ggggagcctgaaccaactccagtagtcaatggagagaaggaaccctccaagggggatcca
aacacagaagagatccggcagagtgacgaggtcggagaccgagaccatcgaaggccacag
gagaagaaaaaagccaagggtttggggaaggagatcacgttgctgatgcagacattgaat
actctgagtaccccagaggagaagctggctgctctgtgcaagaagtatgctgaactgctg
gaggagcaccggaattcacagaagcagatgaagctcctacagaaaaagcagagccagctg
gtgcaagagaaggaccacctgcgcggtgagcacagcaaggccgtcctggcccgcagcaag
cttgagagcctatgccgtgagctgcagcggcacaaccgctccctcaaggaagaaggtgtg
cagcgggcccgggaggaggaggagaagcgcaaggaggtgacctcgcacttccaggtgaca
ctgaatgacattcagctgcagatggaacagcacaatgagcgcaactccaagctgcgccaa
gagaacatggagctggctgagaggctcaagaagctgattgagcagtatgagctgcgcgag
gagcatatcgacaaagtcttcaaacacaaggacctacaacagcagctggtggatgccaag
ctccagcaggcccaggagatgctaaaggaggcagaagagcggcaccagcgggagaaggat
tttctcctgaaagaggcagtagagtcccagaggatgtgtgagctgatgaagcagcaagag
acccacctgaagcaacagcttgccctatacacagagaagtttgaggagttccagaacaca
ctttccaaaagcagcgaggtattcaccacattcaagcaggagatggaaaagatgactaag
aagatcaagaagctggagaaagaaaccaccatgtaccggtcccggtgggagagcagcaac
aaggccctgcttgagatggctgaggagaaaacagtccgggataaagaactggagggcctg
caggtaaaaatccaacggctggagaagctgtgccgggcactgcagacagagcgcaatgac
ctgaacaagagggtacaggacctgagtgctggtggccagggctccctcactgacagtggc
cctgagaggaggccagaggggcctggggctcaagcacccagctcccccagggtcacagaa
gcgccttgctacccaggagcaccgagcacagaagcatcaggccagactgggcctcaagag
cccacctccgccagggcctag

DBGET integrated database retrieval system