KEGG   Homo sapiens (human): 2001
Entry
2001              CDS       T01001                                 

Gene name
ELF5, ESE2
Definition
(RefSeq) E74 like ETS transcription factor 5
  KO
K17101  E74-like factor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    2001 (ELF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2001 (ELF5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2001 (ELF5)
SSDB
Motif
Pfam: Ets SAM_PNT
Other DBs
NCBI-GeneID: 2001
NCBI-ProteinID: NP_938195
OMIM: 605169
HGNC: 3320
Ensembl: ENSG00000135374
Vega: OTTHUMG00000166451
Pharos: Q9UKW6(Tbio)
UniProt: Q9UKW6 A8K443
Structure
PDB: 
1WWX

Position
11p13
AA seq 265 aa
MPSLPHSHRVMLDSVTHSTFLPNASFCDPLMSWTDLFSNEEYYPAFEHQTACDSYWTSVH
PEYWTKRHVWEWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYF
ILQNIRTQGYSFFNDAEESKATIKDYADSNCLKTSGIKSQDCHSHSRTSLQSSHLWEFVR
DLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTG
ILERVDRRLVYKFGKNAHGWQEDKL
NT seq 798 nt   +upstreamnt  +downstreamnt
atgccatctctgcctcactcccacagggtaatgttggactcggtgacacacagcaccttc
ctgcctaatgcatccttctgcgatcccctgatgtcgtggactgatctgttcagcaatgaa
gagtactaccctgcctttgagcatcagacagcctgtgactcatactggacatcagtccac
cctgaatactggactaagcgccatgtgtgggagtggctccagttctgctgcgaccagtac
aagttggacaccaattgcatctccttctgcaacttcaacatcagtggcctgcagctgtgc
agcatgacacaggaggagttcgtcgaggcagctggcctctgcggcgagtacctgtacttc
atcctccagaacatccgcacacaaggttactccttttttaatgacgctgaagaaagcaag
gccaccatcaaagactatgctgattccaactgcttgaaaacaagtggcatcaaaagtcaa
gactgtcacagtcatagtagaacaagcctccaaagttctcatctatgggaatttgtacga
gacctgcttctatctcctgaagaaaactgtggcattctggaatgggaagatagggaacaa
ggaatttttcgggtggttaaatcggaagccctggcaaagatgtggggacaaaggaagaaa
aatgacagaatgacatatgaaaagttgagcagagccctgagatactactataaaacagga
attttggagcgggttgaccgaaggttagtgtacaaatttggaaaaaatgcacacgggtgg
caggaagacaagctatga

DBGET integrated database retrieval system