KEGG   Homo sapiens (human): 200159
Entry
200159            CDS       T01001                                 
Symbol
C1orf100
Name
(RefSeq) chromosome 1 open reading frame 100
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF5530
Other DBs
NCBI-GeneID: 200159
NCBI-ProteinID: NP_001012988
HGNC: 30435
Ensembl: ENSG00000173728
Pharos: Q5SVJ3(Tdark)
UniProt: Q5SVJ3
Position
1:244352635..244389663
AA seq 147 aa
MTAIRLREFIERRPVIPPSIFIAHQGRDVQGYYPGQLARLHFDHSAKRAPRPLIDLTIPP
KTKYHYQPQLDQQTLIRYICLRRHSKPAEPWYKETTYRRDYSLPFYEIDWNQKLATVSLN
PRPLNSLPELYCCEERSSFERNAFKLK
NT seq 444 nt   +upstreamnt  +downstreamnt
atgactgccatccgactacgagaatttattgagcgtcgcccagtgatcccgccaagtata
ttcatcgctcaccaaggaagagacgttcaaggctattaccctgggcagctggcaagactc
cattttgatcatagtgcaaagagagctcccagaccgctcatagacttgacaattccaccc
aagacaaaatatcactatcagcctcaattagaccaacaaacactcattcgatatatttgt
cttcgaagacattcaaagcctgccgagccatggtataaagaaaccacttaccgacgagac
tattctctgccattttatgagattgattggaaccagaaattagccacagtttcgctgaat
cctcgaccgcttaattcactgccagagctctactgttgtgaagagagaagcagctttgaa
agaaatgcttttaaactaaaataa

DBGET integrated database retrieval system