KEGG   Homo sapiens (human): 200172Help
Entry
200172            CDS       T01001                                 

Gene name
SLFNL1
Definition
(RefSeq) schlafen like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: AlbA_2 bZIP_1
Motif
Other DBs
NCBI-GeneID: 200172
NCBI-ProteinID: NP_001161719
HGNC: 26313
Ensembl: ENSG00000171790
Vega: OTTHUMG00000005719
Pharos: Q499Z3(Tdark)
UniProt: Q499Z3 A0A140VJU6
Position
1p34.2
AA seq 407 aa AA seqDB search
MTPMKRSVQTQVSEPFMESWGEESLPELPAEQSLTEYSDLEEAPSAHTLYVGHLNPQFSV
PVLACLLRDTLERLEMPVAREHIEVVRRPRKAYALVQVTVHRDTLASLPWRLQTALEEHL
ILKELAARGKDLLLSEAQGPFSHREEKEEEEEDSGLSPGPSPGSGVPLPTWPTHTLPDRP
QAQQLQSCQGRPSGVCSDSAIVHQQIVGKDQLFQGAFLGSETRNMEFKRGSGEYLSLAFK
HHVRRYVCAFLNSEGGSLLVGVEDSGLVQGIRCSHRDEDRARLLVDSILQGFKPQIFPDA
YTLTFIPVISTSETSVPLKVIRLTVHTPKAQSQPQLYQTDQGEVFLRRDGSIQGPLSASA
IQEWCRQRWLVELGKLEEKMKALMMEKEQLQQQLQQHGPVSCTCCVL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacccccatgaagagatcagtgcaaacacaggtgtcagagcccttcatggagtcctgg
ggtgaggagtccctgccggagctacccgcagagcagtccctgacggagtactctgacctc
gaggaggctccctcggcgcacactctctatgtgggccatctgaacccccagttctcagtg
ccggtgcttgcctgcctgctgcgagacaccctggagcggctggagatgccggtggcgcgg
gagcacattgaagtggtgaggcggccgcggaaggcctatgcactggtgcaggtgactgtc
cacagggacaccctggcctccctcccctggcgcctgcagacggccctggaggagcaccta
atcctcaaggagctggcagcccgtgggaaggacctgctattgagtgaggcccaagggccc
ttcagccacagagaggagaaggaggaggaggaggaggacagtggcctgagccctggcccc
agtccaggctctggtgtcccgctgcccacctggcctacacacacgctgcctgataggccc
caggcccagcagctgcagagctgccagggccggcccagcggcgtgtgctccgacagtgcc
attgtgcaccagcagatcgtgggcaaggaccagctcttccagggtgccttcctgggcagc
gagacccgcaatatggagttcaagcggggtagcggcgagtacctcagcctggccttcaag
caccacgtgcggcgctacgtgtgcgccttcctcaacagcgagggcggcagcctgctcgtg
ggagtagaggacagcggcctggtgcagggcatccgctgcagccaccgtgacgaggaccgc
gcacgcctgctggtggactccatcctgcagggcttcaagcctcagatctttcccgatgcc
tacactctcaccttcatccctgtgatcagtacctcggagaccagcgtccccctcaaggtg
atccgcctgaccgtgcacacccccaaggcccagagccagccgcaactctaccagacagac
cagggggaggtgtttctgcggcgcgacgggagcatccagggcccgctgtctgccagcgcc
atccaggagtggtgcaggcagaggtggctggtggagctgggcaagctggaagagaagatg
aaggcgctgatgatggagaaggagcagctccagcagcagctgcagcagcacgggcctgtg
tcctgcacctgctgtgtcctgtga

DBGET integrated database retrieval system