KEGG   Homo sapiens (human): 2002Help
Entry
2002              CDS       T01001                                 

Gene name
ELK1
Definition
(RefSeq) ELK1, ETS transcription factor
  KO
K04375  ETS domain-containing protein Elk-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05020  Prion diseases
hsa05140  Leishmaniasis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05213  Endometrial cancer
hsa05225  Hepatocellular carcinoma
Network
N00227  TGFA-EGFR-PLCG-PKC signaling pathway
N00228  TGFA-overexpression to PLCG-PKC signaling pathway
N00392  HCMV gB to EGFR-RAS-ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2002 (ELK1)
   04010 MAPK signaling pathway
    2002 (ELK1)
   04012 ErbB signaling pathway
    2002 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2002 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    2002 (ELK1)
   04912 GnRH signaling pathway
    2002 (ELK1)
   04921 Oxytocin signaling pathway
    2002 (ELK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    2002 (ELK1)
   05205 Proteoglycans in cancer
    2002 (ELK1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    2002 (ELK1)
   05213 Endometrial cancer
    2002 (ELK1)
  09164 Neurodegenerative diseases
   05020 Prion diseases
    2002 (ELK1)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    2002 (ELK1)
   05161 Hepatitis B
    2002 (ELK1)
   05163 Human cytomegalovirus infection
    2002 (ELK1)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    2002 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2002 (ELK1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2002 (ELK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 2002
NCBI-ProteinID: NP_001107595
OMIM: 311040
HGNC: 3321
Ensembl: ENSG00000126767
Vega: OTTHUMG00000021452
Pharos: P19419(Tbio)
UniProt: P19419 A0A024R1A7
Structure
PDB: 

Position
Xp11.23
AA seq 428 aa AA seqDB search
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIH
AAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
LPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
GRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH
AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTH
TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
LSPGPQKP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagctgctgagagagcaaggcaat
ggccacatcatctcctggacttcacgggatggtggtgaattcaagctggtggatgcagag
gaggtggcccggctgtgggggctacgcaagaacaagaccaacatgaattacgacaagctc
agccgggccttgcggtactactatgacaagaacatcatccgcaaggtgagcggccagaag
ttcgtctacaagtttgtgtcctaccctgaggtcgcagggtgctccactgaggactgcccg
ccccagccagaggtgtctgttacctccaccatgccaaatgtggcccctgctgctatacat
gccgccccaggggacactgtctctggaaagccaggcacacccaagggtgcaggaatggca
ggcccaggcggtttggcacgcagcagccggaacgagtacatgcgctcgggcctctattcc
accttcaccatccagtctctgcagccgcagccaccccctcatcctcggcctgctgtggtg
ctccccagtgcagctcctgcaggggcagcagcgcccccctcggggagcaggagcaccagt
ccaagccccttggaggcctgtctggaggctgaagaggccggcttgcctctgcaggtcatc
ctgaccccgcccgaggccccaaacctgaaatcggaagagcttaatgtggagccgggtttg
ggccgggctttgcccccagaagtgaaagtagaagggcccaaggaagagttggaagttgcg
ggggagagagggtttgtgccagaaaccaccaaggccgagccagaagtccctccacaggag
ggcgtgccagcccggctgcccgcggttgttatggacaccgcagggcaggcgggcggccat
gcggcttccagccctgagatctcccagccgcagaagggccggaagccccgggacctagag
cttccactcagcccgagcctgctaggtgggccgggacccgaacggaccccaggatcggga
agtggctccggcctccaggctccggggccggcgctgaccccatccctgcttcctacgcat
acattgaccccggtgctgctgacacccagctcgctgcctcctagcattcacttctggagc
accctgagtcccattgcgccccgtagcccggccaagctctccttccagtttccatccagt
ggcagcgcccaggtgcacatcccttctatcagcgtggatggcctctcgacccccgtggtg
ctctccccagggccccagaagccatga

DBGET integrated database retrieval system