KEGG   Homo sapiens (human): 2002Help
Entry
2002              CDS       T01001                                 

Gene name
ELK1
Definition
(RefSeq) ETS transcription factor ELK1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05020  Prion diseases
hsa05140  Leishmaniasis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05213  Endometrial cancer
hsa05225  Hepatocellular carcinoma
Network
nt06110  MAPK signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06220  Calcium signaling
nt06263  Hepatocellular carcinoma
nt06323  KISS1-GnRH-LH-estrogen signaling
  Element
N00227  TGFA-EGFR-PLCG-PKC signaling pathway
N00228  TGFA-overexpression to PLCG-PKC signaling pathway
N00392  HCMV gB to EGFR-RAS-ERK signaling pathway
N00540  HBV HBx to RAS-ERK signaling pathway
N00873  GnRH-GnRHR-PLCB-PKC signaling pathway
N00875  Mutation-inactivated GnRHR to GnRH-GnRHR-PLCB-PKC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2002 (ELK1)
   04010 MAPK signaling pathway
    2002 (ELK1)
   04012 ErbB signaling pathway
    2002 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2002 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    2002 (ELK1)
   04912 GnRH signaling pathway
    2002 (ELK1)
   04921 Oxytocin signaling pathway
    2002 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2002 (ELK1)
   05205 Proteoglycans in cancer
    2002 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2002 (ELK1)
   05213 Endometrial cancer
    2002 (ELK1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    2002 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    2002 (ELK1)
   05161 Hepatitis B
    2002 (ELK1)
   05163 Human cytomegalovirus infection
    2002 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    2002 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2002 (ELK1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2002 (ELK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 2002
NCBI-ProteinID: NP_001107595
OMIM: 311040
HGNC: 3321
Ensembl: ENSG00000126767
Vega: OTTHUMG00000021452
Pharos: P19419(Tbio)
UniProt: P19419 A0A024R1A7
Structure
PDB: 

Position
Xp11.23
AA seq 428 aa AA seqDB search
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIH
AAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
LPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
GRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH
AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTH
TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
LSPGPQKP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagctgctgagagagcaaggcaat
ggccacatcatctcctggacttcacgggatggtggtgaattcaagctggtggatgcagag
gaggtggcccggctgtgggggctacgcaagaacaagaccaacatgaattacgacaagctc
agccgggccttgcggtactactatgacaagaacatcatccgcaaggtgagcggccagaag
ttcgtctacaagtttgtgtcctaccctgaggtcgcagggtgctccactgaggactgcccg
ccccagccagaggtgtctgttacctccaccatgccaaatgtggcccctgctgctatacat
gccgccccaggggacactgtctctggaaagccaggcacacccaagggtgcaggaatggca
ggcccaggcggtttggcacgcagcagccggaacgagtacatgcgctcgggcctctattcc
accttcaccatccagtctctgcagccgcagccaccccctcatcctcggcctgctgtggtg
ctccccagtgcagctcctgcaggggcagcagcgcccccctcggggagcaggagcaccagt
ccaagccccttggaggcctgtctggaggctgaagaggccggcttgcctctgcaggtcatc
ctgaccccgcccgaggccccaaacctgaaatcggaagagcttaatgtggagccgggtttg
ggccgggctttgcccccagaagtgaaagtagaagggcccaaggaagagttggaagttgcg
ggggagagagggtttgtgccagaaaccaccaaggccgagccagaagtccctccacaggag
ggcgtgccagcccggctgcccgcggttgttatggacaccgcagggcaggcgggcggccat
gcggcttccagccctgagatctcccagccgcagaagggccggaagccccgggacctagag
cttccactcagcccgagcctgctaggtgggccgggacccgaacggaccccaggatcggga
agtggctccggcctccaggctccggggccggcgctgaccccatccctgcttcctacgcat
acattgaccccggtgctgctgacacccagctcgctgcctcctagcattcacttctggagc
accctgagtcccattgcgccccgtagcccggccaagctctccttccagtttccatccagt
ggcagcgcccaggtgcacatcccttctatcagcgtggatggcctctcgacccccgtggtg
ctctccccagggccccagaagccatga

KEGG   Homo sapiens (human): 2005Help
Entry
2005              CDS       T01001                                 

Gene name
ELK4, SAP1
Definition
(RefSeq) ETS transcription factor ELK4
  KO
K04376  ETS domain-containing protein Elk-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
hsa05202  Transcriptional misregulation in cancer
Disease
H00024  Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2005 (ELK4)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2005 (ELK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    2005 (ELK4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2005 (ELK4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2005 (ELK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 2005
NCBI-ProteinID: NP_001964
OMIM: 600246
HGNC: 3326
Ensembl: ENSG00000158711
Vega: OTTHUMG00000037221
Pharos: P28324(Tbio)
UniProt: P28324 A0A024R9C2 Q8IXL1
Structure
PDB: 

Position
1q32.1
AA seq 431 aa AA seqDB search
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLS
RALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDV
ENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKS
PQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPT
SASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEP
KDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQ
TPIILTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPST
PGPFSPDLQKT
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggacagtgctatcaccctgtggcagttccttcttcagctcctgcagaagcctcagaac
aagcacatgatctgttggacctctaatgatgggcagtttaagcttttgcaggcagaagag
gtggctcgtctctgggggattcgcaagaacaagcctaacatgaattatgacaaactcagc
cgagccctcagatactattatgtaaagaatatcatcaaaaaagtgaatggtcagaagttt
gtgtacaagtttgtctcttatccagagattttgaacatggatccaatgacagtgggcagg
attgagggtgactgtgaaagtttaaacttcagtgaagtcagcagcagttccaaagatgtg
gagaatggagggaaagataaaccacctcagcctggtgccaagacctctagccgcaatgac
tacatacactctggcttatattcttcatttactctcaactctttgaactcctccaatgta
aagcttttcaaattgataaagactgagaatccagccgagaaactggcagagaaaaaatct
cctcaggagcccacaccatctgtcatcaaatttgtcacgacaccttccaaaaagccaccg
gttgaacctgttgctgccaccatttcaattggcccaagtatttctccatcttcagaagaa
actatccaagctttggagacattggtttccccaaaactgccttccctggaagccccaacc
tctgcctctaacgtaatgactgcttttgccaccacaccacccatttcgtccataccccct
ttgcaggaacctcccagaacaccttcaccaccactgagttctcacccagacatcgacaca
gacattgattcagtggcttctcagccaatggaacttccagagaatttgtcactggagcct
aaagaccaggattcagtcttgctagaaaaggacaaagtaaataattcatcaagatccaag
aaacccaaagggttagaactggcacccacccttgtgatcacgagcagtgatccaagccca
ctgggaatactgagcccatctctccctacagcttctcttacaccagcatttttttcacag
acacccatcatactgactccaagccccttgctctccagtatccacttctggagtactctc
agtcctgttgctcccctaagtccagccagactgcaaggtgctaacacacttttccagttt
ccttctgtactgaacagtcatgggccattcactctgtctgggctggatggaccttccacc
cctggcccattttccccagacctacagaagacataa

KEGG   Homo sapiens (human): 2113Help
Entry
2113              CDS       T01001                                 

Gene name
ETS1, ETS-1, EWSR2, c-ets-1, p54
Definition
(RefSeq) ETS proto-oncogene 1, transcription factor
  KO
K02678  C-ets-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04218  Cellular senescence
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2113 (ETS1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    2113 (ETS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2113 (ETS1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    2113 (ETS1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    2113 (ETS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2113 (ETS1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2113 (ETS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT HSF_DNA-bind
Motif
Other DBs
NCBI-GeneID: 2113
NCBI-ProteinID: NP_005229
OMIM: 164720
HGNC: 3488
Ensembl: ENSG00000134954
Vega: OTTHUMG00000165799
Pharos: P14921(Tbio)
UniProt: P14921 B4DW78
Structure
PDB: 

Position
11q24.3
AA seq 441 aa AA seqDB search
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF
VGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGR
TSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDADE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggccgtcgatctcaagccgactctcaccatcatcaagacggaaaaagtcgat
ctggagcttttcccctccccggatatggaatgtgcagatgtcccactattaactccaagc
agcaaagaaatgatgtctcaagcattaaaagctactttcagtggtttcactaaagaacag
caacgactggggatcccaaaagacccccggcagtggacagaaacccatgttcgggactgg
gtgatgtgggctgtgaatgaattcagcctgaaaggtgtagacttccagaagttctgtatg
aatggagcagccctctgcgccctgggtaaagactgctttctcgagctggccccagacttt
gttggggacatcttatgggaacatctagagatcctgcagaaagaggatgtgaaaccatat
caagttaatggagtcaacccagcctatccagaatcccgctatacctcggattacttcatt
agctatggtattgagcatgcccagtgtgttccaccatcggagttctcagagcccagcttc
atcacagagtcctatcagacgctccatcccatcagctcggaagagctcctctccctcaag
tatgagaatgactacccctcggtcattctccgagaccctctccagacagacaccttgcag
aatgactactttgctatcaaacaagaagtcgtcaccccagacaacatgtgcatggggagg
accagtcgtggtaaactcgggggccaggactcttttgaaagcatagagagctacgatagt
tgtgatcgcctcacccagtcctggagcagccagtcatctttcaacagcctgcagcgtgtt
ccctcctatgacagcttcgactcagaggactatccggctgccctgcccaaccacaagccc
aagggcaccttcaaggactatgtgcgggaccgtgctgacctcaataaggacaagcctgtc
attcctgctgctgccctagctggctacacaggcagtggaccaatccagctatggcagttt
cttctggaattactcactgataaatcctgtcagtcttttatcagctggacaggagatggc
tgggaattcaaactttctgacccagatgaggtggccaggagatggggaaagaggaaaaac
aaacctaagatgaattatgagaaactgagccgtggcctacgctactattacgacaaaaac
atcatccacaagacagcggggaaacgctacgtgtaccgctttgtgtgtgacctgcagagc
ctgctggggtacacccctgaggagctgcacgccatgctggacgtcaagccagatgccgac
gagtga

KEGG   Homo sapiens (human): 2114Help
Entry
2114              CDS       T01001                                 

Gene name
ETS2, ETS2IT1
Definition
(RefSeq) ETS proto-oncogene 2, transcription factor
  KO
K21932  C-ets-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2114 (ETS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    2114 (ETS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2114 (ETS2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2114 (ETS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT
Motif
Other DBs
NCBI-GeneID: 2114
NCBI-ProteinID: NP_005230
OMIM: 164740
HGNC: 3489
Ensembl: ENSG00000157557
Vega: OTTHUMG00000090769
Pharos: P15036(Tbio)
UniProt: P15036
Structure
PDB: 

Position
21q22.2
AA seq 469 aa AA seqDB search
MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSIS
HDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATN
EFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEE
NSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFP
KSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQS
SLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRG
LRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttcggaatcaagaatatggaccaggtagcccctgtggctaacagttacaga
gggacactcaagcgccagccagcctttgacacctttgatgggtccctgtttgctgttttt
ccttctctaaatgaagagcaaacactgcaagaagtgccaacaggcttggattccatttct
catgactccgccaactgtgaattgcctttgttaaccccgtgcagcaaggctgtgatgagt
caagccttaaaagctaccttcagtggcttcaaaaaggaacagcggcgcctgggcattcca
aagaacccctggctgtggagtgagcaacaggtatgccagtggcttctctgggccaccaat
gagttcagtctggtgaacgtgaatctgcagaggttcggcatgaatggccagatgctgtgt
aaccttggcaaggaacgctttctggagctggcacctgactttgtgggtgacattctctgg
gaacatctggagcaaatgatcaaagaaaaccaagaaaagacagaagatcaatatgaagaa
aattcacacctcacctccgttcctcattggattaacagcaatacattaggttttggcaca
gagcaggcgccctatggaatgcagacacagaattaccccaaaggcggcctcctggacagc
atgtgtccggcctccacacccagcgtactcagctctgagcaggagtttcagatgttcccc
aagtctcggctcagctccgtcagcgtcacctactgctctgtcagtcaggacttcccaggc
agcaacttgaatttgctcaccaacaattctgggactcccaaagaccacgactcccctgag
aacggtgcggacagcttcgagagctcagactccctcctccagtcctggaacagccagtcg
tccttgctggatgtgcaacgggttccttccttcgagagcttcgaagatgactgcagccag
tctctctgcctcaataagccaaccatgtctttcaaggattacatccaagagaggagtgac
ccagtggagcaaggcaaaccagttatacctgcagctgtgctggccggcttcacaggaagt
ggacctattcagctgtggcagtttctcctggagctgctatcagacaaatcctgccagtca
ttcatcagctggactggagacggatgggagtttaagctcgccgaccccgatgaggtggcc
cgccggtggggaaagaggaaaaataagcccaagatgaactacgagaagctgagccggggc
ttacgctactattacgacaagaacatcatccacaagacgtcggggaagcgctacgtgtac
cgcttcgtgtgcgacctccagaacttgctggggttcacgcccgaggaactgcacgccatc
ctgggcgtccagcccgacacggaggactga

KEGG   Homo sapiens (human): 6688Help
Entry
6688              CDS       T01001                                 

Gene name
SPI1, OF, PU.1, SFPI1, SPI-1, SPI-A
Definition
(RefSeq) Spi-1 proto-oncogene
  KO
K09438  transcription factor PU.1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00112  AML1-ETO fusion to PU.1-mediated transcription
Disease
H00003  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    6688 (SPI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6688 (SPI1)
   05202 Transcriptional misregulation in cancer
    6688 (SPI1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    6688 (SPI1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    6688 (SPI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6688 (SPI1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    6688 (SPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 6688
NCBI-ProteinID: NP_003111
OMIM: 165170
HGNC: 11241
Ensembl: ENSG00000066336
Vega: OTTHUMG00000150150
Pharos: P17947(Tbio)
UniProt: P17947
Position
11p11.2
AA seq 270 aa AA seqDB search
MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHS
EFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQ
YPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLL
RSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGE
VKKVKKKLTYQFSGEVLGRGGLAERRHPPH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggcgtgcaaaatggaagggtttcccctcgtcccccctccatcagaagacctg
gtgccctatgacacggatctataccaacgccaaacgcacgagtattacccctatctcagc
agtgatggggagagccatagcgaccattactgggacttccacccccaccacgtgcacagc
gagttcgagagcttcgccgagaacaacttcacggagctccagagcgtgcagcccccgcag
ctgcagcagctctaccgccacatggagctggagcagatgcacgtcctcgatacccccatg
gtgccaccccatcccagtcttggccaccaggtctcctacctgccccggatgtgcctccag
tacccatccctgtccccagcccagcccagctcagatgaggaggagggcgagcggcagagc
cccccactggaggtgtctgacggcgaggcggatggcctggagcccgggcctgggctcctg
cctggggagacaggcagcaagaagaagatccgcctgtaccagttcctgttggacctgctc
cgcagcggcgacatgaaggacagcatctggtgggtggacaaggacaagggcaccttccag
ttctcgtccaagcacaaggaggcgctggcgcaccgctggggcatccagaagggcaaccgc
aagaagatgacctaccagaagatggcgcgcgcgctgcgcaactacggcaagacgggcgag
gtcaagaaggtgaagaagaagctcacctaccagttcagcggcgaagtgctgggccgcggg
ggcctggccgagcggcgccacccgccccactga

DBGET integrated database retrieval system