KEGG   Homo sapiens (human): 200350
Entry
200350            CDS       T01001                                 

Gene name
FOXD4L1, FOXD5, bA395L14.1
Definition
(RefSeq) forkhead box D4 like 1
  KO
K09397  forkhead box protein D
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    200350 (FOXD4L1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    200350 (FOXD4L1)
SSDB
Motif
Pfam: Forkhead PBP1_TM
Other DBs
NCBI-GeneID: 200350
NCBI-ProteinID: NP_036316
OMIM: 611084
HGNC: 18521
Ensembl: ENSG00000184492
Vega: OTTHUMG00000131359
Pharos: Q9NU39(Tdark)
UniProt: Q9NU39 B3KVK3
Position
2q14.1
AA seq 408 aa
MNLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPGLQ
VARWGGVALPREHIEGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPYSYIALITMAI
LQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGTY
WSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHPFPLPAAHAALHNPRPGPLLGAPA
LPQPVPGAYPNTAPGRRPYALLHPHPPRYLLLSAPAYAGAPKKAEGADLATPGTLPVLQP
SLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWSYCPLLQRPSS
LSDNFAATAAASGGGLRQRLRSHQGRGAGRAPVGRVGAAAVSGGGRGL
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaacctgccaagagctgagcgccctcgctccacaccgcagcgcagcctccgggactcc
gatggggaagacggtaaaatcgatgtcctgggagaggaggaagatgaagacgaggtggaa
gacgaggaggaggaggcgagccagaagttcctagagcagtcgctccagccggggctgcag
gtggcccggtggggcggggttgcgcttccccgagagcacatcgagggcggcggcccgagc
gacccctcagagtttggcaccgagttcagggcaccgccaaggtctgcggcggcctctgaa
gatgcccggcagccggcaaagcccccctactcgtacatcgcgctcatcaccatggccatc
ctgcaaagcccgcacaagcgcctcacgctcagcggcatctgcgccttcattagtggccgc
ttcccctactaccgccgcaagttccccgcctggcagaacagcatccgccacaacctctcg
ctgaacgactgcttcgtcaagatcccccgcgagccgggccacccaggcaagggcacctac
tggagcctggaccccgcctcccaggacatgttcgacaatggcagctttctccggcgtagg
aagcgtttcaagcgccaccaactgaccccgggagcccacctgccccaccccttccctcta
cctgctgcacacgccgccctgcacaacccccgcccaggccctctgcttggggcccctgcc
ctgccgcagccagtcccgggggcctaccccaacaccgcccccgggagacgcccttacgct
ctgctgcacccgcatcctcctcgctacctactgctctcggcccccgcctatgccggggca
ccgaagaaagcagaaggcgcggacctggcgacccccggcacccttcccgtgctgcagccc
tcacttggtcctcagccttgggaggagggcaagggtctggcgtcgccaccgggaggcgga
tgcatctctttcagcattgagagtatcatgcaaggggtcaggggagcgggtacaggggct
gcgcagagtttgtccccgaccgcgtggagctactgccccctgctccagcgaccgtcaagc
ctgtcggacaattttgcagcaacagcagcagcatcaggaggaggactgcgccaacggctg
cgctcccaccaagggcgcggtgctgggcgggcacctgtcggccgcgtcggcgctgctgcg
gtatcaggcggtggcagagggctctag

DBGET integrated database retrieval system