KEGG   Homo sapiens (human): 2004Help
Entry
2004              CDS       T01001                                 

Gene name
ELK3, ERP, NET, SAP-2, SAP2
Definition
(RefSeq) ETS transcription factor ELK3
  KO
K09430  ETS domain-containing protein Elk-3 (SRF accessory protein 2)
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2004 (ELK3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2004 (ELK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets Translat_reg
Motif
Other DBs
NCBI-GeneID: 2004
NCBI-ProteinID: NP_005221
OMIM: 600247
HGNC: 3325
Ensembl: ENSG00000111145
Vega: OTTHUMG00000170364
Pharos: P41970(Tbio)
UniProt: P41970 A0A024RBE2
Position
12q23.1
AA seq 407 aa AA seqDB search
MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLS
RALRYYYDKNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGRE
AHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVR
TVIRFVTNKTDKHVTRPVVSLPSTSEAAAASAFLASSVSAKISSLMLPNAASISSASPFS
SRSPSLSPNSPLPSEHRSLFLEAACHDSDSLEPLNLSSGSKTKSPSLPPKAKKPKGLEIS
APPLVLSGTDIGSIALNSPALPSGSLTPAFFTAQTPNGLLLTPSPLLSSIHFWSSLSPVA
PLSPARLQGPSTLFQFPTLLNGHMPVPIPSLDRAASPVLLSSNSQKS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggagagtgcaatcacgctgtggcagttcctgttgcagttgctgctggatcagaaacat
gagcatttgatctgctggacctcgaacgatggtgaattcaagctcctcaaagcagaagaa
gtggccaagctgtggggactccgaaaaaacaaaacaaatatgaactatgataagctgagc
agagccctgcgatactattatgacaagaacatcatcaagaaggtgatcgggcagaagttt
gtgtacaagtttgtctctttcccggagatcctgaagatggatcctcacgcggtggagatc
agccgggagagccttctgctgcaggacagcgactgcaaggcgtctccggagggccgcgag
gcccacaaacacggcctggccgccctcagaagcacgagccgcaacgaatacatccactca
ggcctgtactcgtccttcaccattaattccctgcagaacccaccagacgccttcaaggcc
atcaagacggagaagctggaggagccgcccgaagacagcccccccgtggaagaagtcagg
actgtgatcaggtttgtgaccaataaaaccgacaagcacgtcaccaggccggtggtgtcc
ctgccttccacgtcagaggctgcggcggcgtccgccttcctggcctcgtccgtctcggcc
aagatctcctctttaatgttgccaaacgctgccagtatttcatccgcctcacccttctca
tctcggtccccgtccctgtcccccaactcacccctcccttctgaacacagaagcctcttc
ctggaggccgcctgccatgactccgattccctggagcccttgaacctgtcatcgggctcc
aagaccaagtctccatctcttcccccaaaggccaaaaaacccaaaggcttggaaatctca
gcgcccccgctggtgctctccggcaccgacatcggctccatcgccctcaacagcccagcc
ctcccctcgggatccctcaccccagccttcttcaccgcacagacaccaaatggattgctt
ctgactccgagtccactgctctccagcatacatttctggagcagccttagtccagttgct
ccgctgagtcctgccaggctgcaagggccaagcacgctgttccagttccccacactgctt
aatggccacatgccagtgccaatccccagtctggacagagctgcttctccagtactgctt
tcttcaaactctcagaaatcctga

DBGET integrated database retrieval system