KEGG   Homo sapiens (human): 200407
Entry
200407            CDS       T01001                                 
Symbol
CREG2
Name
(RefSeq) cellular repressor of E1A stimulated genes 2
  KO
K25476  protein CREG
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    200407 (CREG2)
SSDB
Motif
Pfam: Pyrid_oxidase_2 Putative_PNPOx
Other DBs
NCBI-GeneID: 200407
NCBI-ProteinID: NP_722578
OMIM: 618540
HGNC: 14272
Ensembl: ENSG00000175874
Pharos: Q8IUH2(Tdark)
UniProt: Q8IUH2
Position
2:complement(101345550..101387503)
AA seq 290 aa
MSVRRGRRPARPGTRLSWLLCCSALLSPAAGYVIVSSVSWAVTNEVDEELDSASTEEAMP
ALLEDSGSIWQQSFPASAHKEDAHLRPRAGAARARPPPAPPGMFSYRREGGQTASAPPGP
RLRAATARSLAHASVWGCLATVSTHKKIQGLPFGNCLPVSDGPFNNSTGIPFFYMTAKDP
VVADLMKNPMASLMLPESEGEFCRKNIVDPEDPRCVQLTLTGQMIAVSPEEVEFAKQAMF
SRHPGMRKWPRQYEWFFMKMRIEHIWLQKWYGGASSISREEYFKAVPRKA
NT seq 873 nt   +upstreamnt  +downstreamnt
atgtccgtgcgccgcggccggcggccggcgcggccggggacccgcctctcctggctgctg
tgctgcagcgccctgctgtccccggccgcgggctacgtgatcgtgagctccgtgtcttgg
gccgtcaccaacgaggtggacgaggagctggacagcgcctccactgaggaggctatgccc
gcgctgctagaggattcgggcagcatctggcagcaaagcttccccgcctctgcccacaag
gaggacgcgcacctgcggccccgggcgggcgccgcccgggccaggccgccccccgcgcca
cccgggatgttctcctaccggcgcgagggcggccagacggccagtgcgcccccgggccct
agactgcgcgccgccaccgcccgctccctggcccatgccagcgtctggggctgcctggcc
accgtgtccacccacaagaagatccaaggactgccatttgggaactgcctgcccgtcagt
gatggccccttcaacaatagcactgggattcctttcttctacatgacagccaaggacccc
gtggtggctgatctgatgaagaaccccatggcctcgctgatgctgccagaatcagaaggg
gagttctgcagaaaaaacatcgttgatccggaagatccccgatgtgtccagttaacgctc
actggccagatgatcgcagtgtctccagaagaagtagaatttgccaagcaagccatgttt
tcaaggcacccagggatgaggaagtggcctcgtcaatatgaatggttctttatgaagatg
aggatagaacatatctggcttcagaaatggtatggaggcgcatccagtatttcaagggag
gaatatttcaaagcagttcccagaaaggcctga

DBGET integrated database retrieval system