KEGG   Homo sapiens (human): 200576
Entry
200576            CDS       T01001                                 

Gene name
PIKFYVE, CFD, FAB1, HEL37, PIP5K, PIP5K3, ZFYVE29
Definition
(RefSeq) phosphoinositide kinase, FYVE-type zinc finger containing
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04145  Phagosome
hsa04810  Regulation of actin cytoskeleton
Disease
H00957  Fleck corneal dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    200576 (PIKFYVE)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    200576 (PIKFYVE)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    200576 (PIKFYVE)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    200576 (PIKFYVE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    200576 (PIKFYVE)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     200576 (PIKFYVE)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    200576 (PIKFYVE)
 Endosome - Golgi transport
  Others
   Others
    200576 (PIKFYVE)
SSDB
Motif
Pfam: PIP5K Cpn60_TCP1 DEP FYVE
Other DBs
NCBI-GeneID: 200576
NCBI-ProteinID: NP_055855
OMIM: 609414
HGNC: 23785
Ensembl: ENSG00000115020
Vega: OTTHUMG00000132945
Pharos: Q9Y2I7(Tbio)
UniProt: Q9Y2I7
Position
2q34
AA seq 2098 aa
MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERA
EGGQGEQQPLSGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSSALDTRRKAEPTFGGH
DPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHC
RLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDSA
CSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNTPLSTRLVSVQEDAGKSP
ARNRSASITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERKILLDSVQLKDLWK
KICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLD
CVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQI
AEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPH
PADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENG
EKQAMERLLSANHNHMMALLQQLLHSDSLSSSWRDIIVSLVCQVVQTVRPDVKNQDDDMD
IRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMSSCIKNPKILLLKCSIEYLYREETK
FTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQVL
ERISRMTQGDLVMSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFFEGCPQHLGCTIK
LRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQNPSFHSLIEGRGHEG
AVQEQYGGGSIPWDPDIPPESLPCDDSSLLELRIVFEKGEQENKNLPQAVASVKHQEHST
TACPAGLPCAFFAPVPESLLPLPVDDQQDALGSEQPETLQQTVVLQDPKSQIRAFRDPLQ
DDTGLYVTEEVTSSEDKRKTYSLAFKQELKDVILCISPVITFREPFLLTEKGMRCSTRDY
FAEQVYWSPLLNKEFKEMENRRKKQLLRDLSGLQGMNGSIQAKSIQVLPSHELVSTRIAE
HLGDSQSLGRMLADYRARGGRIQPKNSDPFAHSKDASSTSSGQSGSKNEGDEERGLILSD
AVWSTKVDCLNPINHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLER
YCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRICK
QVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQMVASF
SYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYVAIDERLASLKTDTFS
KTREEKMEDIFAQKEMEEGEFKNWIEKMQARLMSSSVDTPQQLQSVFESLIAKKQSLCEV
LQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISAMDASPRNISPGLQNGEKEDR
FLTTLSSQSSTSSTHLQLPTPPEVMSEQSVGGPPELDTASSSEDVFDGHLLGSTDSQVKE
KSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALSCKEY
RNALEELSKATQWNSAEEGLPTNSTSDSRPKSSSPIRLPEMSGGQTNRTTETEPQPTKKA
SGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQTGKEGTENQGVEPQDEVDGGDTQ
KKQLINPHVELQFSDANAKFYCRLYYAGEFHKMREVILDSSEEDFIRSLSHSSPWQARGG
KSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIG
YKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLL
KMVRDNPLYIRSHSKAVLRTSIHSDSHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIRT
FTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLGLNC
NT seq 6297 nt   +upstreamnt  +downstreamnt
atggccacagatgataagacgtccccaacactggactctgctaatgatttgcctcgatct
cctactagtccttctcatctcacacactttaaacctttgactcctgatcaagatgagccc
ccttttaaatcagcttatagttcttttgtaaatctctttcgttttaacaaagagagagca
gaaggaggccagggagaacagcagcctttgagtggaagttggaccagccctcagctccct
tcgaggacacagtctgttaggtcacccacaccttataaaaagcagcttaatgaggaactc
cagcggcgctcttcagcattagacacaagaaggaaagcagaacctacctttggaggtcat
gaccctcgtacagctgttcagcttcgaagcctcagcacagtattaaaacgcctcaaggaa
atcatggaggggaaaagccaggatagtgacctgaaacaatactggatgccagatagccaa
tgtaaagagtgctatgactgtagtgagaaatttacaacctttaggcgcagacaccattgc
cgactatgtgggcagattttctgcagtcgttgctgtaatcaagaaatccctggaaaattt
atgggctatacaggagacctccgagcttgcacatattgtagaaaaatagccttaagttat
gctcattccacagacagtaattctattggggaagacttgaatgctctttcagattctgct
tgctctgtgtctgtgcttgatccaagtgaaccccgaacacctgttgggagtaggaaagcc
agccgtaacatatttttagaggatgatttggcctggcaaagtttgattcatccagattcc
tcaaatactcctctttcaacaagacttgtatctgtgcaagaggatgctgggaaatctcct
gctcgaaatagatcagccagcattactaacctgtcactggatagatctggttctcctatg
gtaccttcatatgagacatctgtcagtccccaggctaaccgaacatatgttaggacagag
accactgaggatgaacgcaaaattcttctggacagtgtgcagttaaaagacctgtggaaa
aaaatctgccatcacagcagtggaatggagtttcaggatcaccgctactggttgagaacg
catcccaactgcattgtaggaaaggaattagtcaactggctaatccgaaatgggcatatt
gccacaagggcacaagctatagcaattggacaagcaatggttgatggacgttggctggat
tgtgttagtcatcacgaccagcttttcagagatgagtatgcgctgtatagaccactgcag
agtacagaattttctgagacgccttctcccgacagtgactcagtgaactccgtggaagga
cactctgagccatcctggtttaaagacataaagtttgatgacagtgacacagaacagata
gctgaagaaggtgacgataatttggctaattctgccagtcctagcaagcgcacatcagtc
agcagtttccagtccacagtggacagtgactcagccgcttctatcagcctgaacgtggag
ctggacaacgtgaacttccatatcaagaagccctccaagtacccacatgtgccccctcac
cctgctgaccaaaaagagtatttgatttctgacactggaggacaacagctctcaataagt
gacgctttcatcaaagaatccttatttaatcgccgagtagaggaaaaatccaaagagctg
cctttcacacctttgggctggcatcataacaacctggagctcctgagggaggagaatggg
gagaaacaagccatggagaggttgctttcagctaatcataaccacatgatggcactactc
cagcagttgctccatagtgactcactgtcatcatcttggagggacatcatcgtgtcattg
gtctgccaggttgttcagacagtccgacctgatgtcaagaaccaggatgatgacatggat
atccgtcagtttgtccacatcaaaaaaatcccaggtggaaagaagtttgattctgtggtt
gtcaatggctttgtttgtaccaagaacattgcacataaaaagatgagttcttgtattaaa
aaccccaaaattcttctgttgaagtgttccattgagtatctctacagagaagaaactaag
tttacttgcattgatcctattgtgcttcaggaaagggaattcttgaagaattatgtccag
cgaatagttgatgttcgacccaccttggttcttgttgagaaaacagtgtctcggattgcc
caggacatgttattggaacatggcattactttggtcattaatgtaaagtcacaagttttg
gaacgaatcagtcgaatgacccaaggtgatttagtgatgtcaatggaccagctgcttacg
aaaccacacctgggcacttgtcacaaattttatatgcagatatttcagttgcctaatgaa
caaaccaagacactgatgttttttgaaggttgtccacagcacctaggctgtacaatcaag
ctaagaggaggctctgattatgagctggctcgagttaaggagatcctaatatttatgatc
tgtgttgcttatcattctcaactagaaatatcctttctcatggatgaatttgctatgcct
cccacattaatgcaaaacccttcattccattccctgattgagggacgagggcatgagggg
gctgtccaagagcagtacggtggaggttccatcccctgggatcctgacatccctcctgag
tctctgccctgtgatgatagcagtttgctggaattgaggattgtgtttgagaagggtgag
caggaaaataaaaatcttccgcaggctgttgcctctgtgaagcatcaagaacatagcaca
acagcttgcccggcgggtctcccttgtgctttctttgcacctgtaccggaatcattgttg
ccactccctgtggatgaccaacaagatgctttaggcagcgagcagccagagactttgcag
caaacagttgtgctgcaggatcccaaaagccagataagagcctttagagaccctctacag
gatgacactggattatatgttactgaggaagtcacctcctctgaagataaacgaaagact
tattctttggcctttaagcaggaattaaaagatgtgatcctctgtatctccccagtaatc
acattccgagaaccctttcttttaactgaaaaggggatgagatgctctacccgagattat
tttgcagagcaggtttactggtctcctctcctcaataaagaattcaaagaaatggagaac
aggaggaagaaacagctgctcagggatctctctggacttcagggcatgaatggaagtatt
caggccaagtctattcaagtcttaccctcacatgagctagtgagcactagaattgctgag
catctgggcgatagccagagcttgggtagaatgctggccgattatcgagccagaggagga
agaattcagcccaaaaattcagacccttttgctcattcaaaggatgcatcaagtacttca
agtggccaatcaggaagcaaaaatgagggtgatgaagagagagggcttattctgagtgat
gctgtgtggtcaacaaaggtggactgtctgaatcccattaatcaccagagactttgtgtg
ctcttcagcagctcttctgcccagtccagcaatgctcctagtgcctgtgtcagtccttgg
attgtaacaatggaattttatggaaagaatgatcttacattaggaatatttttagagaga
tactgtttcaggccttcttatcagtgtccaagcatgttctgtgatacccccatggtacat
catattcggcgctttgttcatggccaaggctgtgtgcagataatcctgaaggagttggat
tctccagtacctggatatcagcatacaattcttacatattcctggtgtagaatctgcaaa
caggtaacaccagttgttgctctttccaatgagtcctggtctatgtcatttgcaaaatac
cttgaacttaggttttatgggcaccagtatactcgcagagccaacgctgagccctgtggt
cactccatccatcatgattatcaccagtatttctcctataaccagatggtggcgtctttc
agttattctcccattcggcttcttgaagtatgtgttccactccccaaaatattcattaag
cgtcaggccccattaaaagtgtcccttcttcaggatctgaaggacttctttcaaaaagtt
tcacaggtatatgttgccattgatgaaagacttgcatctttgaaaactgatacatttagt
aaaacaagagaggaaaaaatggaagatatttttgcacagaaagagatggaagaaggtgag
ttcaagaactggattgagaagatgcaagcaaggctcatgtcttcctctgtagatacccct
cagcaactgcagtcggtctttgagtcactcattgccaagaaacaaagtctctgtgaagtg
ctgcaagcttggaataacaggttgcaggaccttttccaacaggaaaagggtagaaagaga
ccttcagttcctccaagtcctggaagactgagacaaggggaagaaagcaagataagtgcg
atggatgcatctccacggaatatttctccaggacttcagaatggagaaaaagaggatcgc
ttcttaacaactttgtccagccagagctccaccagttctactcatctccaattgcctacg
ccacctgaagtcatgtctgaacagtcagtgggagggccccctgagctagatacagccagc
agttccgaagatgtgtttgatgggcatttgctgggatccacagacagccaagtgaaggaa
aagtcaaccatgaaagccatctttgcaaatttgcttccaggaaatagctataatcctatt
ccatttccttttgatccagataaacactacttaatgtatgaacatgaacgagtgcccatt
gcagtctgcgagaaggaacccagctccatcattgcttttgctctcagttgtaaagaatac
cgaaatgccttagaggaattgtctaaagcgactcagtggaacagtgccgaagaagggctt
ccaacaaatagtacttcagatagcagaccaaagagtagcagccctatcagattacctgaa
atgagtggaggacagacaaatcgtacaacagaaacagaaccacaaccaaccaaaaaggct
tctggaatgttgtccttcttcagagggacagcagggaaaagccccgatctctcttcccag
aagagagagaccttacgtggagcagatagtgcttactaccaggttgggcagacgggcaag
gaggggaccgagaatcaaggcgttgagcctcaagatgaagtagatggaggagatacacaa
aagaagcaactcataaatcctcatgtggaacttcaattttcagatgctaatgccaagttt
tactgtcggctctactatgcgggagagtttcataagatgcgtgaagtgattctggacagc
agtgaagaagatttcattcgttccctctcccactcatcaccctggcaggcccggggaggc
aaatcaggagctgccttctatgcaactgaggatgatagatttattttgaagcaaatgcct
cgtctggaagtccagtccttcctcgactttgcaccacattacttcaattatattacaaat
gctgttcaacaaaagaggcccacggcgttggccaaaattcttggagtttacagaattggt
tataagaactctcagaacaacactgagaagaagttagatctccttgtcatggaaaatctt
ttctacgggagaaagatggcacaggtttttgatttgaagggctctcttaggaatcggaat
gtaaaaactgacactggaaaagagagttgtgatgtggtcctgctagatgaaaatctccta
aagatggttcgagacaaccctctatatattcgttctcattccaaagctgtgctgagaacc
tcgatccatagtgactcccatttcctttctagccacctcattatagattattctttgctg
gttgggcgagatgatactagcaatgagctagtagttggaattatagattatattcgaaca
tttacatgggacaaaaagcttgagatggttgtgaaatcaacaggaattttaggtggacaa
ggtaaaatgccaacagtggtgtctccggagttgtacaggactaggttttgtgaggcaatg
gacaagtatttcctaatggtaccagaccactggacaggcttgggtctgaattgctga

KEGG   Homo sapiens (human): 23396
Entry
23396             CDS       T01001                                 

Gene name
PIP5K1C, LCCS3, PIP5K-GAMMA, PIP5K1-gamma, PIP5Kgamma
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase type 1 gamma
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04510  Focal adhesion
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05135  Yersinia infection
hsa05231  Choline metabolism in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H00865  Lethal congenital contractural syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    23396 (PIP5K1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    23396 (PIP5K1C)
   04072 Phospholipase D signaling pathway
    23396 (PIP5K1C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23396 (PIP5K1C)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    23396 (PIP5K1C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    23396 (PIP5K1C)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    23396 (PIP5K1C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    23396 (PIP5K1C)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    23396 (PIP5K1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23396 (PIP5K1C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     23396 (PIP5K1C)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    23396 (PIP5K1C)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    23396 (PIP5K1C)
 Endosome - Golgi transport
  Others
   Others
    23396 (PIP5K1C)
SSDB
Motif
Pfam: PIP5K Toxin_33
Other DBs
NCBI-GeneID: 23396
NCBI-ProteinID: NP_036530
OMIM: 606102
HGNC: 8996
Ensembl: ENSG00000186111
Vega: OTTHUMG00000180870
Pharos: O60331(Tbio)
UniProt: O60331
Position
19p13.3
AA seq 668 aa
MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEVLSMTAQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
ILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDFMQDMPEGLLLDADTFSALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGAQSTSDEKRPVGQKALYSTAMES
IQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQI
PSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSP
SETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEAS
PAGASAAVEVETASQASDEEGAPASQASDEEDAPATDIYFPTDERSWVYSPLHYSAQAPP
ASDGESDT
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggagctggaggtaccggacgaggcggagagcgctgaggcgggggccgtgccctcggag
gcggcgtgggcggcagagagcggggcggcggcaggtttggctcagaagaaggcggcccca
acagaggttctgtccatgacggcacagccgggccctggccatgggaagaagttgggccat
cgaggtgtggacgcatccggcgaaaccacctacaagaagaccacctcctccaccctgaag
ggtgccatccagctgggcatcggctacaccgtgggccacctgagctccaagcccgaacgc
gacgtgctcatgcaggacttctacgtggtggagagcatcttcttccccagcgaaggcagc
aacctcacccccgcccaccacttccaggacttccgcttcaagacctatgcacctgtcgcc
ttccgctacttccgggagctctttgggatccggccagatgattacttgtactccctgtgc
aatgagccgctgatcgagctgtccaacccgggcgccagtggctccctcttctacgtcacc
agcgacgacgagttcatcatcaagaccgtcatgcacaaggaggccgagttcctgcagaag
ctgctccctggctactacatgaacctcaaccagaacccgcggacgctgctgcccaagttc
tatgggctgtactgcgtgcagtcggggggcaagaacatccgcgtcgtggtcatgaacaac
atcctgccccgcgtggtcaagatgcacctcaagttcgacctcaagggctccacctacaag
cggcgcgccagcaagaaggagaaggagaagagcttccccacctacaaggacctggacttc
atgcaggacatgcccgaggggctcctgctggacgccgacaccttcagcgccctggtcaag
acgctgcagcgggactgcctggtcctggaaagtttcaagatcatggactacagcctgctg
ctgggcgtgcacaacatcgaccagcacgagcgcgagcggcaggcgcagggcgcccagagc
acctcagatgagaagcggcctgtgggccagaaggcgctctactccacggccatggagtcc
atccagggtggcgccgcgcgcggggaggccatcgaatcggatgacacgatgggcgggatc
cccgctgtgaacggccgcggggagcggctgctgctgcacattggcatcatcgacatcctg
cagtcctacaggttcatcaagaaactggagcacacctggaaggccctcgtccacgatggg
gacacggtgtccgtccaccgccccagcttctatgccgagcgctttttcaagttcatgagc
aacacggtctttcggaagaactcctccctgaagtcctcgccctccaagaaggggcgcggc
ggagccttgctagctgtgaaaccgctggggcccaccgctgccttctcggccagccagatc
cctagcgagcgggaggaggcccagtacgacctgcggggggcccgcagctaccccacgctg
gaggacgaaggccggcccgacctcctgccctgcacgccaccttctttcgaagaagccact
acagcctccattgccacgactctgtcatccacatccctctccattcctgagcggtccccc
tcggagacgtcggagcagccgcggtacaggcggcgcacacagtcgtctggacaggatggc
aggccgcaggaggagccacccgcggaagaggatctgcagcagattacagtgcaggtggag
cctgcgtgcagcgtggagattgtggtccccaaagaggaggacgcaggggtggaggcttcc
ccggccggtgcctctgctgctgttgaagtagaaactgccagccaggcctcagacgaggag
ggcgcacctgccagccaggcctcggacgaggaggacgcgcccgccaccgacatctacttt
cccaccgatgagaggagctgggtgtactccccgctccactatagcgcccaggcccccccg
gcctccgacggcgagagcgacacataa

KEGG   Homo sapiens (human): 5305
Entry
5305              CDS       T01001                                 

Gene name
PIP4K2A, PI5P4KA, PIP5K2A, PIP5KII-alpha, PIP5KIIA, PIPK
Definition
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase type 2 alpha
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5305 (PIP4K2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    5305 (PIP4K2A)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5305 (PIP4K2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     5305 (PIP4K2A)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 5305
NCBI-ProteinID: NP_005019
OMIM: 603140
HGNC: 8997
Ensembl: ENSG00000150867
Vega: OTTHUMG00000017810
Pharos: P48426(Tbio)
UniProt: P48426
Structure
PDB: 
2YBX

Position
10p12.2
AA seq 406 aa
MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVM
LMPDDFKAYSKIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSA
PLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMHNILKKYHQYIVECHGITLLPQFLG
MYRLNVDGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKAKELPTLKDNDFIN
EGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQEEVECEENDGEE
EGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDI
LTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHILT
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcgacccccggcaacctagggtcctctgtcctggcgagcaagaccaagaccaagaag
aagcacttcgtagcgcagaaagtgaagctgtttcgggccagcgacccgctgctcagcgtc
ctcatgtggggggtaaaccactcgatcaatgaactgagccatgttcaaatccctgttatg
ttgatgccagatgacttcaaagcctattcaaaaataaaggtggacaatcacctttttaac
aaagaaaacatgccgagccatttcaagtttaaggaatactgcccgatggtcttccgtaac
ctgcgggagaggtttggaattgatgatcaagatttccagaattccctgaccaggagcgca
cccctccccaacgactcccaggcccgcagtggagctcgttttcacacttcctacgacaaa
agatacatcatcaagactattaccagtgaagacgtggccgaaatgcacaacatcctgaag
aaataccaccagtacatagtggaatgtcatgggatcacccttcttccccagttcttgggc
atgtaccggcttaatgttgatggagttgaaatatatgtgatagttacaagaaatgtattc
agccaccgtttgtctgtgtataggaaatacgacttaaagggctctacagtggctagagaa
gctagtgacaaagaaaaggccaaagaactgccaactctgaaagataatgatttcattaat
gagggccaaaagatttatattgatgacaacaacaagaaggtcttcctggaaaaactaaaa
aaggatgttgagtttctggcccagctgaagctcatggactacagtctgctggtgggaatt
catgatgtggagagagccgaacaggaggaagtggagtgtgaggagaacgatggggaggag
gagggcgagagcgatggcacccacccggtgggaacccccccagatagccccgggaataca
ctgaacagctcaccacccctggctcccggggagttcgatccgaacatcgacgtctatgga
attaagtgccatgaaaactcgcctaggaaggaggtgtacttcatggcaattattgacatc
cttactcattatgatgcaaaaaagaaagctgcccatgctgcaaaaactgttaaacatggc
gctggcgcggagatctccaccgtgaacccagaacagtattcaaagcgctttttggacttt
attggccacatcttgacgtaa

KEGG   Homo sapiens (human): 79837
Entry
79837             CDS       T01001                                 

Gene name
PIP4K2C, PIP5K2C
Definition
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase type 2 gamma
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    79837 (PIP4K2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    79837 (PIP4K2C)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    79837 (PIP4K2C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     79837 (PIP4K2C)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 79837
NCBI-ProteinID: NP_001139730
OMIM: 617104
HGNC: 23786
Ensembl: ENSG00000166908
Vega: OTTHUMG00000170144
Pharos: Q8TBX8(Tbio)
UniProt: Q8TBX8 B3KQV3
Structure
PDB: 
2GK9

Position
12q13.3
AA seq 421 aa
MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSIN
ELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQ
DYLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT
LLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
KDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEA
PVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAE
GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF
A
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcgtcctcctcggtcccaccagccacggtatcggcggcgacagcaggccccggccca
ggtttcggcttcgcctccaagaccaagaagaagcatttcgtgcagcagaaggtgaaggtg
ttccgggcggccgacccgctggtgggtgtgttcctgtggggcgtagcccactcgatcaat
gagctcagccaggtgcctcccccggtgatgctgctgccagatgactttaaggccagctcc
aagatcaaggtcaacaatcaccttttccacagggaaaatctgcccagtcatttcaagttc
aaggagtattgtccccaggtcttcaggaacctccgtgatcgatttggcattgatgaccaa
gattacttggtgtcccttacccgaaacccccccagcgaaagtgaaggcagtgatggtcgc
ttccttatctcctacgatcggactctggtcatcaaagaagtatccagtgaggacattgct
gacatgcatagcaacctctccaactatcaccagtacattgtgaagtgccatggcaacacg
cttctgccccagttcctggggatgtaccgagtcagtgtggacaacgaagacagctacatg
cttgtgatgcgcaatatgtttagccaccgtcttcctgtgcacaggaagtatgacctcaag
ggttccctagtgtcccgggaagccagcgataaggaaaaggttaaagaattgcccaccctt
aaggatatggactttctcaacaagaaccagaaagtatatattggtgaagaggagaagaaa
atatttctggagaagctgaagagagatgtggagtttctagtgcagctgaagatcatggac
tacagccttctgctaggcatccacgacatcattcggggctctgaaccagaggaggaagcg
cccgtgcgggaggatgagtcagaggtggatggggactgcagcctgactggacctcctgct
ctggtgggctcctatggcacctccccagagggtatcggaggctacatccattcccatcgg
cccctgggcccaggagagtttgagtccttcattgatgtctatgccatccggagtgctgaa
ggagccccccagaaggaggtctacttcatgggcctcattgatatccttacacagtatgat
gctaagaagaaagcagctcatgcagccaaaactgtcaagcatggggctggggcagagatc
tctactgtccatccggagcagtatgctaagcgattcctggattttattaccaacatcttt
gcctaa

KEGG   Homo sapiens (human): 8394
Entry
8394              CDS       T01001                                 

Gene name
PIP5K1A
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase type 1 alpha
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04510  Focal adhesion
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05135  Yersinia infection
hsa05231  Choline metabolism in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8394 (PIP5K1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8394 (PIP5K1A)
   04072 Phospholipase D signaling pathway
    8394 (PIP5K1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8394 (PIP5K1A)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    8394 (PIP5K1A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8394 (PIP5K1A)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8394 (PIP5K1A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8394 (PIP5K1A)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    8394 (PIP5K1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8394 (PIP5K1A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     8394 (PIP5K1A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    8394 (PIP5K1A)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    8394 (PIP5K1A)
 Endosome - Golgi transport
  Others
   Others
    8394 (PIP5K1A)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 8394
NCBI-ProteinID: NP_001129110
OMIM: 603275
HGNC: 8994
Ensembl: ENSG00000143398
Vega: OTTHUMG00000012351
Pharos: Q99755(Tbio)
UniProt: Q99755
Position
1q21.3
AA seq 562 aa
MASASSGPSSSVGFSSFDPAVPSCTLSSAASGIKRPMASEVLEARQDSYISLVPYASGMP
IKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIF
FPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASG
SLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIR
IVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADM
YNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALY
STAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWK
ALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGSSGNSC
ITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGET
LQMLTTSTTLEKLEVAESEFTH
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggcgtcggcctcctccgggccgtcgtcttcggtcggtttttcatcctttgatcccgcg
gtcccttcctgtaccttgtcctcagcagcatctggaatcaagagacccatggcatctgag
gtcttggaagctagacaggattcttacatctcattggtgccttatgcctctggcatgccc
atcaagaaaataggccatagaagtgttgattcctcaggagagacaacatataaaaagaca
acctcatcagccttgaaaggtgccatccagttaggcattacccacactgtggggagcctg
agtaccaaaccagagcgtgatgtcctcatgcaagatttctacgtggttgagagtatcttc
tttcccagtgaagggagcaacctgacccctgctcatcactacaatgactttcgtttcaag
acctatgcacctgttgccttccgctacttccgggagctatttggtatccggcccgatgat
tacttgtattccctctgcagtgagccgctgattgaactctgtagctctggagctagtggt
tccctattctatgtgtccagcgacgatgagttcattattaagacagtccaacataaagag
gcggaatttctgcagaagctgcttccaggatactacatgaacctcaaccagaaccctcgg
actttgctgcctaaattctatggactgtactgtgtgcaggcaggtggcaagaacattcgg
attgtggtgatgaacaatcttttaccaagatcggtaaaaatgcatatcaaatatgacctc
aaaggctcaacctacaaacggcgggcttcccagaaagagcgagagaagcctcttcccaca
tttaaagacctagacttcttacaagacatccctgatggtctttttttggatgctgacatg
tacaacgctctctgtaagaccctgcagcgtgactgtttggtgctgcagagcttcaagata
atggattacagcctcttgatgtcaatccataatatagatcatgcacaacgagagccctta
agcagtgaaacacagtactcagttgatactcgaagaccggccccccaaaaggctctgtat
tccacagccatggaatccatccagggagaggctcgacggggtggtaccatggagactgat
gaccatatgggtggcatccctgcccggaatagtaaaggggaaaggcttctgctttatatt
ggcatcattgacattctacagtcttacaggtttgttaagaagttggagcactcttggaaa
gccctggtacatgacggagacactgtctcagtgcatcgcccaggcttctacgctgaacgg
ttccagcgcttcatgtgcaacacagtatttaagaagattcccttgaagccttctccttcc
aaaaagtttcggtctggctcatctttctctcggcgagcaggctccagtggcaactcctgc
attacttaccagccatcggtctctggggaacacaaggcacaagtgacaacaaaggcagaa
gtggagccaggcgttcaccttggtcgtcctgatgttttacctcagactccacctttggag
gaaatcagtgagggctcgcctattcctgaccccagtttctcacctctagttggagagact
ttgcaaatgctaactacaagtacaaccttggaaaagcttgaagttgcagagtcagagttc
acccattaa

KEGG   Homo sapiens (human): 8395
Entry
8395              CDS       T01001                                 

Gene name
PIP5K1B, MSS4, STM7
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase type 1 beta
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04510  Focal adhesion
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05135  Yersinia infection
hsa05231  Choline metabolism in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8395 (PIP5K1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8395 (PIP5K1B)
   04072 Phospholipase D signaling pathway
    8395 (PIP5K1B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8395 (PIP5K1B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    8395 (PIP5K1B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8395 (PIP5K1B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8395 (PIP5K1B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8395 (PIP5K1B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    8395 (PIP5K1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8395 (PIP5K1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     8395 (PIP5K1B)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    8395 (PIP5K1B)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    8395 (PIP5K1B)
 Endosome - Golgi transport
  Others
   Others
    8395 (PIP5K1B)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 8395
NCBI-ProteinID: NP_003549
OMIM: 602745
HGNC: 8995
Ensembl: ENSG00000107242
Vega: OTTHUMG00000019976
Pharos: O14986(Tbio)
UniProt: O14986 Q7KYT6
Position
9q21.11
AA seq 540 aa
MSSAAENGEAAPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSLKEKEEETPQNVPDAKRTGMQ
KVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT
SQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVNEHYPHDRPTLYSNSKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtcttctgctgctgaaaatggagaggcagcacctggaaaacaaaatgaagaaaaaacc
tataaaaagactgcatcatctgctattaaaggtgctattcagctgggaataggatacaca
gtgggtaatctcacttccaagccagaacgagatgttcttatgcaagacttttatgtggtg
gaaagtgtgttcctacccagcgaagggagcaatctgaccccagcacatcactacccagac
tttagatttaagacatacgctccattagcattccgatatttcagagaactttttggtatc
aagcctgatgattacttgtattccatctgcagtgaacctctaatagaactgtctaaccct
ggagccagtggatccttgttttttgtgaccagtgatgatgaatttatcatcaaaacagtt
cagcacaaagaagctgagtttcttcagaagctactgccaggctattacatgaatttaaac
cagaatccaaggactcttttgccaaaattttacggactgtattgtatgcaatcaggaggc
attaatatcaggattgtggtgatgaacaacgttttgccacgctccatgagaatgcacttt
acatatgacttgaaaggctcaacgtataagcgaagagcatcccgtaaagagagagagaaa
tccaaccccacatttaaggacttagatttcctgcaagacatgcacgaagggttgtatttt
gatacggaaacatacaacgcgcttatgaaaacacttcagagagactgccgggtgctagaa
agcttcaagatcatggattatagccttctgttgggaattcatttcctggaccattccctc
aaagagaaagaggaggagaccccacaaaatgtgcctgatgctaagcggactgggatgcag
aaggttctctactcaacagccatggaatctatccagggtccagggaaatctggagatggg
ataatcacagagaacccagacacaatgggaggcattccagctaaaagccataggggagaa
aaactacttttatttatgggcattattgacattctgcaatcatataggttaatgaagaag
ttagaacattcctggaaagctcttgtttatgatggggacactgtttctgttcatagacca
agcttttatgcagacagatttcttaagttcatgaattccagagttttcaagaaaattcaa
gctttgaaggcttcaccgtctaagaaacggtgcaattcaatcgccgccctaaaggccact
tcacaggagattgtgtcctcaattagccaggaatggaaggatgagaagcgggatttgctg
actgaaggacaaagttttagcagccttgatgaagaagccctgggatcccgacacaggcca
gacctggtccctagcactccatcactgtttgaagctgcttccttggcaaccacaatttca
tcttcttccttatacgtcaatgagcactatccacacgacaggcctacactctattcaaac
agcaaagggttaccttccagttcaacatttaccttggaagaggggaccatctacttgacc
gctgagcccaacactctggaagtgcaggatgacaatgcttctgtgcttgacgtctattta
taa

KEGG   Homo sapiens (human): 8396
Entry
8396              CDS       T01001                                 

Gene name
PIP4K2B, PI5P4KB, PIP5K2B, PIP5KIIB, PIP5KIIbeta, PIP5P4KB
Definition
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase type 2 beta
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8396 (PIP4K2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8396 (PIP4K2B)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8396 (PIP4K2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     8396 (PIP4K2B)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 8396
NCBI-ProteinID: NP_003550
OMIM: 603261
HGNC: 8998
Ensembl: ENSG00000276293
Vega: OTTHUMG00000188504
Pharos: P78356(Tchem)
UniProt: P78356
Structure
PDB: 

Position
17q12
AA seq 416 aa
MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNV
PVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNS
VTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLL
PQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKD
NDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEE
RAEDEECENDGVGGNLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESSPKK
EVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgtcgtccaactgcaccagcaccacggcggtggcggtggcgccgctcagcgccagcaag
accaagaccaagaagaagcatttcgtgtgccagaaagtgaagctattccgggccagcgag
ccgatcctcagcgtcctgatgtggggggtgaaccacacgatcaatgagctgagcaatgtt
cctgttcctgtcatgctaatgccagatgacttcaaagcctacagcaagatcaaggtggac
aatcatctcttcaataaggagaacctgcccagccgctttaagtttaaggagtattgcccc
atggtgttccgaaaccttcgggagaggtttggaattgatgatcaggattaccagaattca
gtgacgcgcagcgcccccatcaacagtgacagccagggtcggtgtggcacgcgtttcctc
accacctacgaccggcgctttgtcatcaagactgtgtccagcgaggacgtggcggagatg
cacaacatcttaaagaaataccaccagtttatagtggagtgtcatggcaacacgcttttg
ccacagttcctgggcatgtaccgcctgaccgtggatggtgtggaaacctacatggtggtt
accaggaacgtgttcagccatcggctcactgtgcatcgcaagtatgacctcaagggttct
acggttgccagagaagcgagcgacaaggagaaggccaaggacttgccaacattcaaagac
aatgacttcctcaatgaagggcagaagctgcatgtgggagaggagagtaaaaagaacttc
ctggagaaactgaagcgggacgttgagttcttggcacagctgaagatcatggactacagc
ctgctggtgggcatccacgacgtggaccgggcagagcaggaggagatggaggtggaggag
cgggcagaggacgaggagtgtgagaatgatggggtgggtggcaacctactctgctcctat
ggcacacctccggacagccctggcaacctcctcagctttcctcggttctttggtcctggg
gaattcgacccctctgttgacgtctatgccatgaaaagccatgaaagttcccccaagaag
gaggtgtatttcatggccatcattgatatcctcacgccatacgatacaaagaagaaagct
gcacatgctgccaaaacggtgaaacacggggcaggggccgagatctcgactgtgaaccct
gagcagtactccaaacgcttcaacgagtttatgtccaacatcctgacgtag

DBGET integrated database retrieval system