KEGG   Homo sapiens (human): 200734
Entry
200734            CDS       T01001                                 

Gene name
SPRED2, Spred-2
Definition
(RefSeq) sprouty related EVH1 domain containing 2
  KO
K04703  sprouty-related, EVH1 domain-containing protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    200734 (SPRED2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     200734 (SPRED2)
SSDB
Motif
Pfam: Sprouty WH1
Other DBs
NCBI-GeneID: 200734
NCBI-ProteinID: NP_861449
OMIM: 609292
HGNC: 17722
Ensembl: ENSG00000198369
Vega: OTTHUMG00000152737
Pharos: Q7Z698(Tbio)
UniProt: Q7Z698 B3KPL5
Structure
PDB: 
2JP2

Position
2p14
AA seq 418 aa
MTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIH
GERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIE
DLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTL
GHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEIVRINPREKIWMTGYEDYRHAPVRGKY
PDPSEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGSVIKTQPSRGKSRRR
KEDGERSRCVYCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGD
YTDPCSCDTSDEKFCLRWMALIALSFLAPCMCCYLPLRACYHCGVMCRCCGGKHKAAA
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgaccgaagaaacacacccagacgatgacagctatattgtgcgtgtcaaggctgtggtt
atgaccagagatgactccagcgggggatggttcccacaggaaggaggcgggatcagtcgc
gtcggggtctgtaaggtcatgcaccccgaaggcaatggacgaagcggctttctcatccat
ggtgaacgacagaaagacaaactggtggtattggaatgctatgtaagaaaggacttggtc
tacaccaaagccaatccaacgtttcatcactggaaggtcgataataggaagtttggactt
actttccaaagccctgctgatgcccgagcctttgacaggggagtaaggaaagcaatcgaa
gaccttatagaaggttcaacaacgtcatcttccaccatccataatgaagctgagcttggc
gatgatgacgtttttacaacagctacagacagttcttctaattcctctcagaagagagag
caacctactcggacaatctcctctcccacatcctgtgagcaccggaggatttataccctg
ggccacctccacgactcataccccacagaccactatcacctcgatcagccgatgccaagg
ccctaccgccaggtgagcttcccggacgacgacgaggagatcgtgcgcatcaacccccgg
gagaagatctggatgacggggtacgaggattaccggcacgcacccgtcaggggcaagtac
ccggacccctcggaggacgcggactcctcctacgtgcgcttcgccaagggcgaggtcccc
aagcatgactacaactacccctacgtggactcctcagactttggcctaggcgaggacccc
aaaggccgcgggggcagcgtgatcaagacgcagccctcccggggcaagtcgcggcggcgg
aaggaggacggagagcgctcgcggtgcgtgtactgcagggacatgttcaaccacgaggag
aaccgccggggccactgccaggacgcgcccgactccgtgagaacttgcatccgccgggtg
agctgcatgtggtgcgcggacagcatgctctatcactgtatgtcggaccccgagggagac
tatacagacccttgctcgtgcgatactagcgacgagaagttttgcctccggtggatggct
cttattgccttgtctttcctggccccctgtatgtgctgttacctgccccttcgggcctgc
taccactgcggagtgatgtgcaggtgctgtggcgggaagcacaaagcggccgcgtga

DBGET integrated database retrieval system