KEGG   Homo sapiens (human): 200916
Entry
200916            CDS       T01001                                 

Gene name
RPL22L1
Definition
(RefSeq) ribosomal protein L22 like 1
  KO
K02891  large subunit ribosomal protein L22e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    200916 (RPL22L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    200916 (RPL22L1)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    200916 (RPL22L1)
SSDB
Motif
Pfam: Ribosomal_L22e CamS
Other DBs
NCBI-GeneID: 200916
NCBI-ProteinID: NP_001093115
HGNC: 27610
Ensembl: ENSG00000163584
Vega: OTTHUMG00000158957
Pharos: Q6P5R6(Tdark)
UniProt: Q6P5R6
Position
3q26.2
AA seq 122 aa
MAPQKDRKPKRSTWRFNLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERF
KNKITVVSEKQFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDESES
ED
NT seq 369 nt   +upstreamnt  +downstreamnt
atggcgccgcagaaagacaggaagcccaagaggtcaacctggaggtttaatttggacctt
actcatccagtagaagatggaatttttgattctggaaattttgagcaatttctacgggag
aaggttaaagtcaatggcaaaactggaaatctcgggaatgttgttcacattgaacgcttc
aagaataaaatcacagttgtttctgagaaacagttctctaaaaggtatttgaaatacctt
accaagaaataccttaagaagaacaatcttcgtgattggcttcgagtggttgcatctgac
aaggagacctacgaacttcgttacttccagattagtcaagatgaagatgaatcagagtcg
gaggactag

DBGET integrated database retrieval system