KEGG   Homo sapiens (human): 200931Help
Entry
200931            CDS       T01001                                 

Gene name
SLC51A, OSTA, OSTalpha
Definition
(RefSeq) solute carrier family 51 alpha subunit
  KO
K14360  organic solute transporter subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    200931 (SLC51A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    200931 (SLC51A)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC51: Transporter of steroid-derived molecules
   200931 (SLC51A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Solute_trans_a
Motif
Other DBs
NCBI-GeneID: 200931
NCBI-ProteinID: NP_689885
OMIM: 612084
HGNC: 29955
Ensembl: ENSG00000163959
Vega: OTTHUMG00000155684
Pharos: Q86UW1(Tbio)
UniProt: Q86UW1
Position
3q29
AA seq 340 aa AA seqDB search
MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGPVELALTSILTLL
ALGSIAIFLEDAVYLYKNTLCPIKRRTLLWKSSAPTVVSVLCCFGLWIPRSLVLVEMTIT
SFYAVCFYLLMLVMVEGFGGKEAVLRTLRDTPMMVHTGPCCCCCPCCPRLLLTRKKLQLL
MLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVSTLLALWTLGIIS
RQARLHLGEQNMGAKFALFQVLLILTALQPSIFSVLANGGQIACSPPYSSKTRSQVMNCH
LLILETFLMTVLTRMYYRRKDHKVGYETFSSPDLDLNLKA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggagccgggcaggacccagataaagcttgaccccaggtacacagcagatcttctggag
gtgctgaagaccaattacggcatcccctccgcctgcttctctcagcctcccacagcagcc
caactcctgagagccctgggccctgtggaacttgccctcactagcatcctgaccttgctg
gcgctgggctccattgccatcttcctggaggatgccgtctacctgtacaagaacaccctt
tgccccatcaagaggcggactctgctctggaagagctcggcacccacggtggtgtctgtg
ctgtgctgctttggtctctggatccctcgttccctggtgctggtggaaatgaccatcacc
tcgttttatgccgtgtgcttttacctgctgatgctggtcatggtggaaggctttgggggg
aaggaggcagtgctgaggacgctgagggacaccccgatgatggtccacacaggcccctgc
tgctgctgctgcccctgctgtccacggctgctgctcaccaggaagaagcttcagctgctg
atgttgggccctttccaatacgccttcttgaagataacgctgaccctggtgggcctgttt
ctcgtccccgacggcatctatgacccagcagacatttctgaggggagcacagctctatgg
atcaacactttccttggcgtgtccacactgctggctctctggaccctgggcatcatttcc
cgtcaagccaggctacacctgggtgagcagaacatgggagccaaatttgctctgttccag
gttctcctcatcctgactgccctacagccctccatcttctcagtcttggccaacggtggg
cagattgcttgttcgcctccctattcctctaaaaccaggtctcaagtgatgaattgccac
ctcctcatactggagacttttctaatgactgtgctgacacgaatgtactaccgaaggaaa
gaccacaaggttgggtatgaaactttctcttctccagacctggacttgaacctcaaagcc
taa

DBGET integrated database retrieval system