KEGG   Homo sapiens (human): 200958
Entry
200958            CDS       T01001                                 

Gene name
MUC20, MUC-20
Definition
(RefSeq) mucin 20, cell surface associated
  KO
K22021  mucin-20
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    200958 (MUC20)
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Membrane bound mucins
    200958 (MUC20)
SSDB
Other DBs
NCBI-GeneID: 200958
NCBI-ProteinID: NP_001269435
OMIM: 610360
HGNC: 23282
Ensembl: ENSG00000176945
Vega: OTTHUMG00000155823
Pharos: Q8N307(Tbio)
UniProt: Q8N307
Position
3q29
AA seq 709 aa
MGCLWGLALPLFFFCWEVGVSGSSAGPSTRRADTAMTTDDTEVPAMTLAPGHAALETQTL
SAETSSRASTPAGPIPEAETRGAKRISPARETRSFTKTSPNFMVLIATSVETSAASGSPE
GAGMTTVQTITGSDPREAIFDTLCTDDSSEEAKTLTMDILTLAHTSTEAKGLSSESSASS
DSPHPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSRASESSASSDGP
HPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHPV
ITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSRASESSASSDGLHPVITP
SRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSWSPGSDVTLLAEALVTVTNIE
VINCSITEIETTTSSIPGASDTDLIPTEGVKASSTSDPPALPDSTEAKPHITEVTASAET
LSTAGTTESAAPDATVGTPLPTNSATEREVTAPGATTLSGALVTVSRNPLEETSALSVET
PSYVKVSGAAPVSIEAGSAVGKTTSFAGSSASSYSPSEAALKNFTPSETPTMDIATKGPF
PTSRDPLPSVPPTTTNSSRGTNSTLAKITTSAKTTMKPPTATPTTARTRPTTDVSAGENG
GFLLLRLSVASPEDLTDPRVAERLMQQLHRELHAHAPHFQVSLLRVRRG
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgggctgtctctggggtctggctctgccccttttcttcttctgctgggaggttggggtc
tctgggagctctgcaggccccagcacccgcagagcagacactgcgatgacaacggacgac
acagaagtgcccgctatgactctagcaccgggccacgccgctctggaaactcaaacgctg
agcgctgagacctcttctagggcctcaaccccagccggccccattccagaagcagagacc
aggggagccaagagaatttcccctgcaagagagaccaggagtttcacaaaaacatctccc
aacttcatggtgctgatcgccacctccgtggagacatcagccgccagtggcagccccgag
ggagctggaatgaccacagttcagaccatcacaggcagtgatcccagggaagccatcttt
gacaccctttgcaccgatgacagctctgaagaggcaaagacactcacaatggacatattg
acattggctcacacctccacagaagctaagggcctgtcctcagagagcagcgcctcttcc
gacagcccccatccagtcatcaccccgtcacgggcctcagagagcagcgcctcttccgac
ggcccccatccagtcatcaccccgtcacgggcctcagagagcagcgcctcttccgacggc
ccccatccagtcatcaccccgtcacgggcctcagagagcagcgcctcttccgacggcccc
catccagtcatcaccccgtcacgggcctcagagagcagcgcctcttccgacggcccccat
ccagtcatcaccccgtcacgggcctcagagagcagcgcctcttccgacggcccccatcca
gtcatcaccccgtcacgggcctcagagagcagcgcctcttccgacggcccccatccagtc
atcaccccgtcacgggcctcagagagcagcgcctcttccgacggcccccatccagtcatc
accccgtcacgggcctcagagagcagcgcctcttccgacggcccccatccagtcatcacc
ccgtcacgggcctcagagagcagcgcctcttccgacggcctccatccagtcatcaccccg
tcacgggcctcagagagcagcgcctcttccgacggcccccatccagtcatcaccccgtca
cgggcctcagagagcagcgcctcttccgacggcccccatccagtcatcaccccctcatgg
tccccgggatctgacgtcactctcctcgctgaagccctggtgactgtcacaaacatcgag
gttattaattgcagcatcacagaaatagaaacaacgacttccagcatccctggggcctca
gacacagatctcatccccacggaaggggtgaaggcctcgtccacctccgatccaccagct
ctgcctgactccactgaagcaaaaccacacatcactgaggtcacagcctctgccgagacc
ctgtccacagccggcaccacagagtcagctgcacctgatgccacggttgggaccccactc
cccactaacagcgccacagaaagagaagtgacagcacccggggccacgaccctcagtgga
gctctggtcacagttagcaggaatccccttgaagaaacctcagccctctctgttgagaca
ccaagttacgtcaaagtctcaggagcagctccggtctccatagaggctgggtcagcagtg
ggcaaaacaacttcctttgctgggagctctgcttcctcctacagcccctcggaagccgcc
ctcaagaacttcaccccttcagagacaccgaccatggacatcgcaaccaaggggcccttc
cccaccagcagggaccctcttccttctgtccctccgactacaaccaacagcagccgaggg
acgaacagcaccttagccaagatcacaacctcagcgaagaccacgatgaagcccccaaca
gccacgcccacgactgcccggacgaggccgaccacagacgtgagtgcaggtgaaaatgga
ggtttcctcctcctgcggctgagtgtggcttccccggaagacctcactgaccccagagtg
gcagaaaggctgatgcagcagctccaccgggaactccacgcccacgcgcctcacttccag
gtctccttactgcgtgtcaggagaggctaa

DBGET integrated database retrieval system