KEGG   Homo sapiens (human): 201134
Entry
201134            CDS       T01001                                 
Symbol
CEP112, CCDC46, MACOCO, SPGF44
Name
(RefSeq) centrosomal protein 112
  KO
K16767  centrosomal protein CEP112
Organism
hsa  Homo sapiens (human)
Disease
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    201134 (CEP112)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    201134 (CEP112)
SSDB
Motif
Pfam: DUF4485
Other DBs
NCBI-GeneID: 201134
NCBI-ProteinID: NP_001186094
OMIM: 618980
HGNC: 28514
Ensembl: ENSG00000154240
Pharos: Q8N8E3(Tdark)
UniProt: Q8N8E3
Position
17:complement(65635537..66192133)
AA seq 955 aa
MEVGSEEEKWEKLDAEFDHFVVDMKPFVLKLPHRTERQRCALWIRKLCEPSGTGAGIMGR
KNRNLYAKLLLHMLKRGALEGPFTHRPEPGTLKILPSYMSIYFDEPNPARAKGSSPEGLP
AWVLGELETSEHKLNESWKLSSGEDNTLVQSPTDVYSREQYTGKLRVRSHSLSPTHREDG
QNITPKICEVYSKKSPVSLDDSDIEARLNSWNLGIENPRYLRQKPIPVSLMTPKFSLRKS
SSFHDDHFLSRIREKELDMKTKMMEAKFHEEKLKLQQKHDADVQKILERKNNEIEELKTL
YRSKQHETEETIRKLEKKVQTLIRDCQVIRETKEDQIAELKKICEQSTESLNNDWEKKLH
NAVAEMEQEKFDLQKQHTENIQELLEDTNVRLNKMESEYMAQTQSTNHMIKELEARVQQL
TGEAENSNLQRQKLIQEKAELERCYQITCSELQEVKARRNTLHKEKDHLVNDYEQNMKLL
QTKYDADINLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQENKFQM
EKSHLKHIYEKKAHDLQSELDKGKEDTQKKIHKFEEALKEKEEQLTRVTEVQRLQAQQAD
AALEEFKRQVELNSEKVYAEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDIRQRYEQQ
IVELKLEHEQEKTHLLQQHNAEKDSLVRDHEREIENLEKQLRAANMEHENQIQEFKKRDA
QVIADMEAQVHKLREELINVNSQRKQQLVELGLLREEEKQRATREHEIVVNKLKAESEKM
KIELKKTHAAETEMTLEKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQL
AAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQI
TYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGRR
NT seq 2868 nt   +upstreamnt  +downstreamnt
atggaagtgggaagtgaagaagaaaaatgggagaagctggatgcagaatttgatcacttt
gtggttgatatgaagccctttgttctaaaattacctcataggacagaacggcagaggtgt
gctctttggattagaaagctgtgcgaaccttcaggaacaggtgcaggaataatggggagg
aagaatcggaacctgtatgcaaaattgttattgcatatgcttaaacgaggtgcgcttgaa
ggcccttttacacaccgacctgaacccgggacactaaaaattctaccttcatacatgtcc
atctattttgatgaaccaaatccagcacgagcaaaaggttcaagcccagagggattacca
gcctgggtactgggtgagctggagacaagtgaacacaaattaaatgaatcatggaaactc
tcttctggagaagataacactttagtacagtcgccaactgatgtctacagcagggaacag
tacactgggaagctccgagtgagatcacactccttgagtccaactcacagagaagatgga
caaaatattaccccaaagatttgtgaagtttattcgaaaaaatctcctgtttctttggat
gatagtgacattgaagctcgccttaatagttggaatcttgggatagaaaatcctcgatac
ctgagacagaagcctatcccagtttctctgatgacaccgaaattcagcctgagaaaatcc
agcagtttccatgatgatcattttctctctcgaatacgtgagaaagagctggacatgaaa
acaaaaatgatggaagctaaatttcatgaagaaaagcttaaactgcaacagaaacatgat
gctgatgttcagaagattttagaaagaaagaataatgaaatagaagaactgaaaacttta
tacaggagtaaacaacatgaaactgaagagactattagaaagcttgaaaagaaagttcag
acactgatacgtgactgtcaagttatcagagagactaaagaagaccagattgcagagctg
aaaaagatatgtgaacaaagtacggaatctctaaataatgactgggaaaaaaagcttcac
aatgctgtagcagaaatggaacaggaaaagtttgatcttcaaaagcaacacactgaaaac
attcaagaattgcttgaggatacaaatgtgcgtctgaataaaatggagagtgaatacatg
gcgcaaacacagtccacaaaccacatgatcaaagaactggaggcccgtgtccagcagctg
actggagaagcagagaacagtaatttacagaggcagaaattaattcaagaaaaagcagaa
cttgaaagatgttaccagataacgtgtagtgaattacaagaagtaaaggcaaggcgtaac
acactgcataaagagaaggaccatcttgtaaatgattatgagcaaaacatgaaactgtta
caaaccaaatatgatgctgatataaaccttctaaaacaagaacatgctctttcagcttct
aaggcatctagtatgattgaagaattagagcagaatgtctgtcaattaaaacagcagtta
caggaatcagaacttcaaagaaagcaacaactaagggatcaagaaaataagtttcagatg
gagaaaagtcatttaaaacacatctatgaaaaaaaggctcatgacttgcagagtgaactt
gataaaggaaaagaagatactcaaaagaaaattcataaatttgaggaagctttgaaggaa
aaagaggagcagctaactcgtgtgactgaagttcagaggttgcaggcccagcaggcagat
gccgctctggaagagtttaagcggcaggtggaactgaactcagagaaagtctatgctgaa
atgaaagagcagatggaaaaagtggaggcagatctaactagatccaaatctcttcgtgag
aaacaatcaaaggagtttttatggcaactggaggacatcagacagcggtatgaacaacag
atagtagagctgaagctggagcatgaacaggagaagacgcacctattacagcagcataac
gcagagaaggatagcctagtccgagaccatgaacgggaaattgaaaacctggaaaaacag
cttcgcgctgccaatatggagcacgaaaatcaaattcaggagttcaagaaacgagatgca
caggttattgccgacatggaggcccaggttcacaagttgagagaagaattgatcaatgtg
aactcacagcggaaacagcagctggtagagcttggtcttcttcgtgaagaggaaaagcaa
agggctacaagggaacatgagattgtcgtcaataaactgaaggctgaatcagaaaagatg
aaaatagagctgaaaaagactcatgctgctgagacagagatgacactggaaaaggccaac
agcaagctgaagcagattgagaaggaatacactcagaagcttgccaaatcttcacagatc
atagcagaacttcagacaaccatttcctctctgaaagaagagaacagccagcagcagctt
gctgcagaaaggcggctccaggatgttagacaaaagtttgaagatgagaagaagcagctg
attagagataatgaccaagcaatcaaggttttacaagatgaattagaaaaccgttctaat
caggtgcgatgtgcagagaaaaaattacaacacaaagaattggagtcacaggaacagata
acttacatacgacaagaatatgaaacaaaattgaaaggattgatgccagcatccctaaga
caagaacttgaagacaccatttcctccctaaaatcacaggttaattttctgcaaaagaga
gcttccatccttcaggaagaactgactacatatcaaggcagaaggtaa

DBGET integrated database retrieval system