KEGG   Homo sapiens (human): 201161
Entry
201161            CDS       T01001                                 
Symbol
CENPV, 3110013H01Rik, CENP-V, PRR6, p30
Name
(RefSeq) centromere protein V
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: GFA Ribosomal_L37e Mito_fiss_reg
Other DBs
NCBI-GeneID: 201161
NCBI-ProteinID: NP_859067
OMIM: 608139
HGNC: 29920
Ensembl: ENSG00000166582
Pharos: Q7Z7K6(Tbio)
UniProt: Q7Z7K6
Position
17:complement(16342537..16353469)
AA seq 272 aa
MRRSRSSAAAKLRGQKRSGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPPSEK
PRLRRSSPRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWETFQK
RQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQNR
HFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDE
GTVRSMVTEEFNGSDWEKAMKEHKTIKNMSKE
NT seq 819 nt   +upstreamnt  +downstreamnt
atgcggcgatcgaggagctctgcggccgccaagctgcgcgggcagaagcggtccggggcc
tccgcggcccccgcggcctccgcggccgctgccttggcacccagcgccacccgcacacgg
cgctccgctagccaggccgggagcaagagccaggcggtggagaagccgccgtcggagaag
ccgcggctgaggcgctcgtcgccgcgggcccaggaggagggcccgggggagccgccgccg
cctgagctggcgttgctcccgccaccgccgccgccgccgccgactcccgcgaccccgacg
tcctcggcgtccaacctggacctgggcgagcagcgggagcgctgggagacgttccagaag
cggcagaagcttacctccgagggtgccgccaagctcctgctagacacctttgaataccag
ggcctggtgaagcacacaggaggctgccactgtggagcagttcgttttgaagtttgggcc
tcagcagacttgcatatatttgactgcaattgcagcatttgcaagaagaagcagaataga
cacttcattgttccagcttctcgcttcaagctcctgaagggagctgagcacataacgact
tacacgttcaatactcacaaagcccagcataccttctgtaagagatgtggcgttcagagc
ttctatactccacgatcaaaccccggaggcttcggaattgccccccactgcctggatgag
ggcactgtgcggagtatggtcactgaggaattcaatggcagcgattgggagaaggccatg
aaagagcacaagaccatcaagaacatgtctaaagagtga

DBGET integrated database retrieval system