KEGG   Homo sapiens (human): 201232
Entry
201232            CDS       T01001                                 
Symbol
SLC16A13, MCT13
Name
(RefSeq) solute carrier family 16 member 13
  KO
K08189  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    201232 (SLC16A13)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   201232 (SLC16A13)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    201232 (SLC16A13)
SSDB
Motif
Pfam: MFS_1 ATG22 Sugar_tr
Other DBs
NCBI-GeneID: 201232
NCBI-ProteinID: NP_963860
HGNC: 31037
Ensembl: ENSG00000174327
Pharos: Q7RTY0(Tdark)
UniProt: Q7RTY0
Position
17:7036015..7040117
AA seq 426 aa
MARRTEPPDGGWGWVVVLSAFFQSALVFGVLRSFGVFFVEFVAAFEEQAARVSWIASIGI
AVQQFGSPVGSALSTKFGPRPVVMTGGILAALGMLLASFATSLTHLYLSIGLLSGSGWAL
TFAPTLACLSCYFSRRRSLATGLALTGVGLSSFTFAPFFQWLLSHYAWRGSLLLVSALSL
HLVACGALLRPPSLAEDPAVGGPRAQLTSLLHHGPFLRYTVALTLINTGYFIPYLHLVAH
LQDLDWDPLPAAFLLSVVAISDLVGRVVSGWLGDAVPGPVTRLLMLWTTLTGVSLALFPV
AQAPTALVALAVAYGFTSGALAPLAFSVLPELIGTRRIYCGLGLLQMIESIGGLLGPPLS
GYLRDVTGNYTASFVVAGAFLLSGSGILLTLPHFFCFSTTTSGPQDLVTEALDTKVPLPK
EGLEED
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcgcgcaggacagagccccccgacgggggctggggatgggtggtggtgctctcagcg
ttcttccagtcggcgcttgtgtttggggtgctccgctcctttggggtcttcttcgtggag
tttgtggcggcgtttgaggagcaggcagcgcgcgtctcctggatcgcctccataggaatc
gcggtgcagcagtttgggagcccggtaggcagtgccctgagcacgaagttcgggcccagg
cccgtggtgatgactggaggcatcttggctgcgctggggatgctgctcgcctcttttgct
acttccttgacccacctatacctgagtattgggttgctgtcaggctctggctgggctttg
accttcgctccgaccctggcctgcctgtcctgttatttctctcgccgacgatccctggcc
accgggctggcactgacaggcgtgggcctctcctccttcacatttgccccctttttccag
tggctgctcagccactacgcctggagggggtccctgctgctggtgtctgccctctccctc
cacctagtggcctgtggtgctctcctccgcccaccctccctggctgaggaccctgctgtg
ggtggtcccagggcccaactcacctctctcctccatcatggccccttcctccgttacact
gttgccctcaccctgatcaacactggctacttcattccctacctccacctggtggcccat
ctccaggacctggattgggacccactacctgctgccttcctactctcagttgttgctatt
tctgacctcgtggggcgtgtggtctccggatggctgggagatgcagtcccagggcctgtg
acacgactcctgatgctctggaccaccttgactggggtgtcactagccctgttccctgta
gctcaggctcccacagccctggtggctctggctgtggcctacggcttcacatcaggggct
ctggccccactggccttctccgtgctgcctgaactaatagggactagaaggatttactgt
ggcctgggactgttgcagatgatagagagcatcggggggctgctggggcctcctctctca
ggctacctccgggatgtgacaggcaactacacggcttcttttgtggtggctggggccttc
cttctttcagggagtggcattctcctcaccctgccccacttcttctgcttctcaactact
acctccgggccccaggaccttgtaacagaagcactagatactaaagttcccctacccaag
gaggggctggaagaggactga

DBGET integrated database retrieval system