KEGG   Homo sapiens (human): 201254
Entry
201254            CDS       T01001                                 
Symbol
CENPX, CENP-X, D9, FAAP10, MHF2, STRA13
Name
(RefSeq) centromere protein X
  KO
K15360  centromere protein X
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    201254 (CENPX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    201254 (CENPX)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     201254 (CENPX)
SSDB
Motif
Pfam: CENP-X CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 201254
NCBI-ProteinID: NP_001257935
OMIM: 615128
HGNC: 11422
Ensembl: ENSG00000169689
Pharos: A8MT69(Tbio)
UniProt: A8MT69
Structure
Position
17:complement(82018703..82022878)
AA seq 81 aa
MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAE
DALRVDVDQLEKVLPQLLLDF
NT seq 246 nt   +upstreamnt  +downstreamnt
atggagggagcaggagctggatccggcttccggaaggagctggtgagcaggctgctgcac
ctgcacttcaaggatgacaagaccaaagtgagcggggacgcgctgcagctcatggtggag
ttgctgaaggtcttcgttgtggaagcagcagtccgcggcgtgcggcaggcccaggcagaa
gacgcgctccgtgtggacgtggaccagctggagaaggtgcttccgcagctgctcctggac
ttctag

DBGET integrated database retrieval system