KEGG   Homo sapiens (human): 2015Help
Entry
2015              CDS       T01001                                 

Gene name
ADGRE1, EMR1, TM7LN3
Definition
(RefSeq) adhesion G protein-coupled receptor E1
  KO
K04591  adhesion G protein-coupled receptor E1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    2015 (ADGRE1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2015 (ADGRE1)
Peptidases [BR:hsa01002]
 Mixed Peptidases
  Family P2
   2015 (ADGRE1)
G protein-coupled receptors [BR:hsa04030]
 Adhesion receptor family
  EGF-like module-containing mucin-like hormone receptor-like (EMR)
   2015 (ADGRE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 EGF_CA cEGF EGF_3 EGF_MSP1_1 hEGF FXa_inhibition EGF GAIN EB
Motif
Other DBs
NCBI-GeneID: 2015
NCBI-ProteinID: NP_001965
OMIM: 600493
HGNC: 3336
Ensembl: ENSG00000174837
Vega: OTTHUMG00000181966
Pharos: Q14246(Tbio)
UniProt: Q14246
Position
19p13.3-p13.2
AA seq 886 aa AA seqDB search
MRGFNLLLFWGCCVMHSWEGHIRPTRKPNTKGNNCRDSTLCPAYATCTNTVDSYYCACKQ
GFLSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGRYKCSCLDGFSSPTGNDW
VPGKPGNFSCTDINECLTSSVCPEHSDCVNSMGSYSCSCQVGFISRNSTCEDVDECADPR
ACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLKASCEDIDECTEMCPINSTCTNTPG
SYFCTCHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTCGPNSICTNALGSYSCGCIAGF
HPNPEGSQKDGNFSCQRVLFKCKEDVIPDNKQIQQCQEGTAVKPAYVSFCAQINNIFSVL
DKVCENKTTVVSLKNTTESFVPVLKQISTWTKFTKEETSSLATVFLESVESMTLASFWKP
SANITPAVRTEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAF
VSFVGMESVLNERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQ
PKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMANLAVIMASGELTMDF
SLYIISHVGIIISLVCLVLAIATFLLCRSIRNHNTYLHLHLCVCLLLAKTLFLAGIHKTD
NKMGCAIIAGFLHYLFLACFFWMLVEAVILFLMVRNLKVVNYFSSRNIKMLHICAFGYGL
PMLVVVISASVQPQGYGMHNRCWLNTETGFIWSFLGPVCTVIVINSLLLTWTLWILRQRL
SSVNAEVSTLKDTRLLTFKAFAQLFILGCSWVLGIFQIGPVAGVMAYLFTIINSLQGAFI
FLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggcttcaacctgctcctcttctggggatgttgtgttatgcacagctgggaaggg
cacataagacccacacggaaaccaaacacaaagggtaataactgtagagacagtaccttg
tgcccagcttatgccacctgcaccaatacagtggacagttactattgcgcttgcaaacaa
ggcttcctgtccagcaatgggcaaaatcacttcaaggatccaggagtgcgatgcaaagat
attgatgaatgttctcaaagcccccagccctgtggtcctaactcatcctgcaaaaacctg
tcagggaggtacaagtgcagctgtttagatggtttctcttctcccactggaaatgactgg
gtcccaggaaagccgggcaatttctcctgtactgatatcaatgagtgcctcaccagcagc
gtctgccctgagcattctgactgtgtcaactccatgggaagctacagttgcagctgtcaa
gttggattcatctctagaaactccacctgtgaagacgtggatgaatgtgcagatccaaga
gcttgcccagagcatgcaacttgtaataacactgttggaaactactcttgtttctgcaac
ccaggatttgaatccagcagtggccacttgagtttccagggtctcaaagcatcgtgtgaa
gatattgatgaatgcactgaaatgtgccccatcaattcaacatgcaccaacactcctggg
agctacttttgcacctgccaccctggctttgcaccaagcaatggacagttgaatttcaca
gaccaaggagtggaatgtagagatattgatgagtgccgccaagatccatcaacctgtggt
cctaattctatctgcaccaatgccctgggctcctacagctgtggctgcattgcaggcttt
catcccaatccagaaggctcccagaaagatggcaacttcagctgccaaagggttctcttc
aaatgtaaggaagatgtgatacccgataataagcagatccagcaatgccaagagggaacc
gcagtgaaacctgcatatgtctccttttgtgcacaaataaataacatcttcagcgttctg
gacaaagtgtgtgaaaataaaacgaccgtagtttctctgaagaatacaactgagagcttt
gtccctgtgcttaaacaaatatccacgtggactaaattcaccaaggaagagacgtcctcc
ctggccacagtcttcctggagagtgtggaaagcatgacactggcatctttttggaaaccc
tcagcaaatatcactccggctgttcggacggaatacttagacattgagagcaaagttatc
aacaaagaatgcagtgaagagaatgtgacgttggacttggtagccaagggggataagatg
aagatcgggtgttccacaattgaggaatctgaatccacagagaccactggtgtggctttt
gtctcctttgtgggcatggaatcggttttaaatgagcgcttcttcaaagaccaccaggct
cccttgaccacctctgagatcaagctgaagatgaattctcgagtcgttgggggcataatg
actggagagaagaaagacggcttctcagatccaatcatctacactctggagaacattcag
ccaaagcagaagtttgagaggcccatctgtgtttcctggagcactgatgtgaagggtgga
agatggacatcctttggctgtgtgatcctggaagcttctgagacatataccatctgcagc
tgtaatcagatggcaaatcttgccgttatcatggcgtctggggagctcacgatggacttt
tccttgtacatcattagccatgtaggcattatcatctccttggtgtgcctcgtcttggcc
atcgccacctttctgctgtgtcgctccatccgaaatcacaacacctacctccacctgcac
ctctgcgtgtgtctcctcttggcgaagactctcttcctcgccggtatacacaagactgac
aacaagatgggctgcgccatcatcgcgggcttcctgcactaccttttccttgcctgcttc
ttctggatgctggtggaggctgtgatactgttcttgatggtcagaaacctgaaggtggtg
aattacttcagctctcgcaacatcaagatgctgcacatctgtgcctttggttatgggctg
ccgatgctggtggtggtgatctctgccagtgtgcagccacagggctatggaatgcataat
cgctgctggctgaatacagagacagggttcatctggagtttcttggggccagtttgcaca
gttatagtgatcaactcccttctcctgacctggaccttgtggatcctgaggcagaggctt
tccagtgttaatgccgaagtctcaacgctaaaagacaccaggttactgaccttcaaggcc
tttgcccagctcttcatcctgggctgctcctgggtgctgggcatttttcagattggacct
gtggcaggtgtcatggcttacctgttcaccatcatcaacagcctgcagggggccttcatc
ttcctcatccactgtctgctcaacggccaggtacgagaagaatacaagaggtggatcact
gggaagacgaagcccagctcccagtcccagacctcaaggatcttgctgtcctccatgcca
tccgcttccaagacgggttaa

DBGET integrated database retrieval system