KEGG   Homo sapiens (human): 2019Help
Entry
2019              CDS       T01001                                 

Gene name
EN1
Definition
(RefSeq) engrailed homeobox 1
  KO
K09319  homeobox protein engrailed
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2019 (EN1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, En
    2019 (EN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Engrail_1_C_sig DUF2316 Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 2019
NCBI-ProteinID: NP_001417
OMIM: 131290
HGNC: 3342
Ensembl: ENSG00000163064
Vega: OTTHUMG00000131401
Pharos: Q05925(Tbio)
UniProt: Q05925
Position
2q14.2
AA seq 392 aa AA seqDB search
MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPP
AAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKE
QPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPP
DGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGT
KYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNE
KEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKK
ATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacagcagccggaacctaaaagtcagcgcgactcggccctcggcgcggcggcg
gcggcgactccgggcggcctcagcctgagcctcagtccgggcgccagcggcagcagcggc
agcggcagcgatggagacagcgtgccggtgtccccgcagcctgcgcccccctcgccgccc
gcggcgccttgcctgccgcccctggcccaccacccgcacctccccccacaccccccgccc
ccgccgcctcagcatctcgcggcgcctgctcaccagccgcagccagcggcccagctgcac
cgcaccaccaactttttcatcgacaacatcctgaggccggacttcggctgcaaaaaggag
cagccgccaccgcagcttctggtggctgcggcggccagaggaggcgcaggaggaggaggc
cgggtcgagcgtgacagaggccagactgccgcaggtagagaccctgtccacccgttgggc
acccgggcgccaggcgctgcctcgctcctgtgcgccccggacgcgaactgtggcccaccc
gacggctcccagccagccgccgccggcgcgggcgcgtctaaagctgggaacccggctgcg
gcggcggcggcggccgcggcggcagtggcggcggcggcggcggccgcagcagccaagccc
tcggacaccggtggcggcggcagtggaggcggcgcggggagccccggagcgcagggcacc
aaatacccggagcacggcaacccggctatcctacttatgggctcagccaacggcgggccc
gtggtcaaaactgactcgcagcagcctctcgtatggcccgcctgggtgtactgcacacgt
tattcggatcgtccatcctccggtccgcgcaccaggaagctgaagaagaagaagaacgag
aaggaggacaagcggccgcggaccgcgttcacggccgagcagctgcagagactcaaggcg
gagttccaggcaaaccgctacatcacggagcagcggcggcagaccctggcccaggaactc
agcctcaacgagtcccagatcaagatctggttccagaacaagcgcgccaagatcaagaaa
gccacaggcatcaagaacggcctggcgctgcacctcatggcccagggactgtacaaccac
tccaccaccacggtccaggacaaagacgagagcgagtag

DBGET integrated database retrieval system