KEGG   Homo sapiens (human): 201931
Entry
201931            CDS       T01001                                 
Symbol
TMEM192
Name
(RefSeq) transmembrane protein 192
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: TMEM192 DUF6535 SlyX
Other DBs
NCBI-GeneID: 201931
NCBI-ProteinID: NP_001093859
OMIM: 620677
HGNC: 26775
Ensembl: ENSG00000170088
UniProt: Q8IY95
Position
4:complement(165070608..165112860)
AA seq 271 aa
MAAGGRMEDGSLDITQSIEDDPLLDAQLLPHHSLQAHFRPRFHPLPTVIIVNLLWFIHLV
FVVLAFLTGVLCSYPNPNEDKCPGNYTNPLKVQTVIILGKVILWILHLLLECYIQYHHSK
IRNRGYNLIYRSTRHLKRLALMIQSSGNTVLLLILCMQHSFPEPGRLYLDLILAILALEL
ICSLICLLIYTVKIRRFNKAKPEPDILEEEKIYAYPSNITSETGFRTISSLEEIVEKQGD
TIEYLKRHNALLSKRLLALTSSDLGCQPSRT
NT seq 816 nt   +upstreamnt  +downstreamnt
atggcggcggggggcaggatggaggacggttccttggatatcacccagagtattgaagac
gacccacttctggatgcccagcttctcccacaccactcattacaagctcactttagaccc
cgattccatcctcttcctacagtcatcatagtgaatcttctgtggtttattcatctcgtg
tttgttgttttagcatttttaacaggtgtgctttgttcttatcctaatccaaatgaggac
aagtgcccaggaaattacacaaacccattgaaagttcagacggttataatccttgggaaa
gttattttgtggattctccatttactccttgaatgctacatccagtatcaccacagcaaa
atcagaaaccgaggctataacttgatctaccgatcaacaaggcatctcaagagacttgcg
ttgatgatacagtcctctggcaacacagtgcttctcctcatactgtgcatgcagcactcc
ttcccagagcctggcagattgtatcttgacctcattctggccatcttggcactggaactc
atctgttccctgatatgtctcctcatttacacagtgaaaatccggagatttaataaagct
aaaccagagcctgatatacttgaagaagaaaaaatctatgcttaccccagcaatattacc
tcggagactggattcagaactatttcaagcctagaagaaattgttgaaaagcaaggagac
accattgaatacctgaagcgacacaatgcgctgctgagtaagcgattgttggctctcact
tcctcagacctgggctgtcagccaagtagaacgtga

DBGET integrated database retrieval system