KEGG   Homo sapiens (human): 202
Entry
202               CDS       T01001                                 
Symbol
CRYBG1, AIM1, ST4
Name
(RefSeq) crystallin beta-gamma domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Crystall Ricin_B_lectin RicinB_lectin_2
Other DBs
NCBI-GeneID: 202
NCBI-ProteinID: NP_001615
OMIM: 601797
HGNC: 356
Ensembl: ENSG00000112297
Pharos: Q9Y4K1(Tbio)
UniProt: Q9Y4K1 B3KPT0
Structure
Position
6:106360717..106572017
AA seq 1723 aa
MEKRSSGRRSGRRRGSQKSTDSPGADAELPESAARDDAVFDDEVAPNAASDNASAEKKVK
SPRAALDGGVASAASPESKPSPGTKGQLRGESDRSKQPPPASSPTKRKGRSRALEAVPAP
PASGPRAPAKESPPKRVPDPSPVTKGTAAESGEEAARAIPRELPVKSSSLLPEIKPEHKR
GPLPNHFNGRAEGGRSRELGRAAGAPGASDADGLKPRNHFGVGRSTVTTKVTLPAKPKHV
ELNLKTPKNLDSLGNEHNPFSQPVHKGNTATKISLFENKRTNSSPRHTDIRGQRNTPASS
KTFVGRAKLNLAKKAKEMEQPEKKVMPNSPQNGVLVKETAIETKVTVSEEEILPATRGMN
GDSSENQALGPQPNQDDKADVQTDAGCLSEPVASALIPVKDHKLLEKEDSEAADSKSLVL
ENVTDTAQDIPTTVDTKDLPPTAMPKPQHTFSDSQSPAESSPGPSLSLSAPAPGDVPKDT
CVQSPISSFPCTDLKVSENHKGCVLPVSRQNNEKMPLLELGGETTPPLSTERSPEAVGSE
CPSRVLVQVRSFVLPVESTQDVSSQVIPESSEVREVQLPTCHSNEPEVVSVASCAPPQEE
VLGNEHSHCTAELAAKSGPQVIPPASEKTLPIQAQSQGSRTPLMAESSPTNSPSSGNHLA
TPQRPDQTVTNGQDSPASLLNISAGSDDSVFDSSSDMEKFTEIIKQMDSAVCMPMKRKKA
RMPNSPAPHFAMPPIHEDHLEKVFDPKVFTFGLGKKKESQPEMSPALHLMQNLDTKSKLR
PKRASAEQSVLFKSLHTNTNGNSEPLVMPEINDKENRDVTNGGIKRSRLEKSALFSSLLS
SLPQDKIFSPSVTSVNTMTTAFSTSQNGSLSQSSVSQPTTEGAPPCGLNKEQSNLLPDNS
LKVFNFNSSSTSHSSLKSPSHMEKYPQKEKTKEDLDSRSNLHLPETKFSELSKLKNDDME
KANHIESVIKSNLPNCANSDTDFMGLFKSSRYDPSISFSGMSLSDTMTLRGSVQNKLNPR
PGKVVIYSEPDVSEKCIEVFSDIQDCSSWSLSPVILIKVVRGCWILYEQPNFEGHSIPLE
EGELELSGLWGIEDILERHEEAESDKPVVIGSIRHVVQDYRVSHIDLFTEPEGLGILSSY
FDDTEEMQGFGVMQKTCSMKVHWGTWLIYEEPGFQGVPFILEPGEYPDLSFWDTEEAYIG
SMRPLKMGGRKVEFPTDPKVVVYEKPFFEGKCVELETGMCSFVMEGGETEEATGDDHLPF
TSVGSMKVLRGIWVAYEKPGFTGHQYLLEEGEYRDWKAWGGYNGELQSLRPILGDFSNAH
MIMYSEKNFGSKGSSIDVLGIVANLKETGYGVKTQSINVLSGVWVAYENPDFTGEQYILD
KGFYTSFEDWGGKNCKISSVQPICLDSFTGPRRRNQIHLFSEPQFQGHSQSFEETTSQID
DSFSTKSCRVSGGSWVVYDGENFTGNQYVLEEGHYPCLSAMGCPPGATFKSLRFIDVEFS
EPTIILFEREDFKGKKIELNAETVNLRSLGFNTQIRSVQVIGGIWVTYEYGSYRGRQFLL
SPAEVPNWYEFSGCRQIGSLRPFVQKRIYFRLRNKATGLFMSTNGNLEDLKLLRIQVMED
VGADDQIWIYQEGCIKCRIAEDCCLTIVGSLVTSGSKLGLALDQNADSQFWSLKSDGRIY
SKLKPNLVLDIKGGTQYDQNHIILNTVSKEKFTQVWEAMVLYT
NT seq 5172 nt   +upstreamnt  +downstreamnt
atggagaagaggtccagcggccgtaggtcggggaggcggagggggtcgcagaaatccacc
gactcccccggcgcggacgccgagctccctgagagcgctgccagggacgacgcggtgttc
gacgacgaggtggcgccaaacgcggccagcgataacgcctcggcggaaaagaaagtgaaa
tctccgcgggcagccctcgacgggggcgttgcctccgctgcgagcccagagtccaagccc
agccccggtaccaaagggcagctccgaggggagtcggaccggagcaaacagccacccccg
gcttcgtcccccacgaagaggaagggcaggagccgtgccctcgaggccgtgcccgccccg
cccgccagcggcccccgggctcccgccaaggagtccccacccaagagggtgcccgatccc
agcccagtcaccaagggcactgcggccgagagcggggaggaggcggcgcgggccatcccc
cgcgagctcccggtcaagagcagctcgctgctgccggagatcaagcccgagcacaagagg
ggcccgctccccaaccacttcaacggccgggcagagggaggtcgaagcagagagctgggc
agagcggccggagcgcctggagcttctgacgccgacggcttgaagcccaggaaccatttc
ggcgtgggcaggtcgacagtgaccactaaagtgaccctccctgccaagcccaaacatgtg
gaactaaatcttaaaacccctaagaatcttgacagtttgggaaatgagcacaatccattt
agccagccagttcacaaaggcaacactgccaccaaaatctccttatttgaaaacaaacgg
acaaacagtagcccaagacacactgacattcgaggccaaaggaatactcctgcctctagt
aaaacgtttgttgggagggcaaagctgaatttagccaaaaaagccaaagaaatggagcaa
cctgaaaagaaagtaatgccaaacagtccccagaatggtgtgctggttaaggaaactgct
atagaaaccaaagttaccgtctcggaagaagagattctgccagcaaccagaggaatgaat
ggagactcttctgagaatcaagctcttggtcctcagcctaaccaagatgataaagcagat
gtacaaacagatgctggctgcctttcagaaccagtggcttctgctctgattcctgtcaag
gatcataagctcttagagaaggaggactcagaggctgcagacagcaaaagccttgtactt
gaaaatgtaaccgatacagcacaagacatccccaccactgtggataccaaagatttacct
ccaacggccatgccaaagccacagcatacattttctgactcacagtcccctgctgagtca
tctcctgggccttctctttcactgtctgcacccgctcctggggatgttcccaaagacaca
tgtgttcaatcacccataagcagtttcccatgcactgatctaaaagtgtcagaaaaccat
aaaggatgtgttttgcctgtgtctcgtcagaacaatgagaaaatgccacttttagaactt
ggaggagaaacaacccctcctttgtccacagagcgtagtccagaagctgtgggaagtgag
tgtccatccagagtcctcgtccaggtcaggtccttcgtgctccccgtggagagcacccag
gatgtgagctcccaggtcatcccagagagctctgaagttagagaagtgcagttgccaact
tgtcacagtaatgaacctgaagtggtttccgttgcaagttgtgctcccccacaagaggaa
gtactgggcaatgaacactctcattgcacagcagagctcgcggcaaaatctggcccacaa
gtcataccgccagcatcagagaaaactctgcctattcaggctcaaagtcagggcagcaga
acacccctgatggctgaatccagtcccaccaactctcccagcagcggaaatcacttagcc
actcctcaaaggccagatcagactgttacaaatggccaggatagccctgccagccttttg
aacatttctgctggtagtgatgatagtgtatttgattcttcttctgatatggaaaaattc
actgaaattataaaacagatggatagcgcagtttgtatgcccatgaaaagaaagaaggcc
aggatgccaaactctcctgctcctcactttgccatgcctcctattcacgaagaccattta
gaaaaggtgtttgatcccaaagtgtttacctttggtttggggaagaagaaggaaagtcag
ccagaaatgtcaccggctttacatttgatgcagaaccttgacacaaaatccaaactgaga
cccaaacgtgcatctgctgaacagagcgtcctcttcaagtccctgcacaccaacactaat
gggaacagtgagcctctggtgatgccggaaatcaatgacaaagagaacagggacgtcaca
aatggtggcattaagagatcgagactagaaaaaagtgcacttttctcaagcttgttatct
tctttaccacaagacaaaatcttttctccttctgtgacatcagtcaacactatgaccacg
gctttcagtacttctcagaacggttccctatctcagtcttcagtgtcacagcccacgact
gagggtgccccgccctgtggtttgaacaaagaacagtcaaatcttctgcccgacaactcc
ttaaaggtcttcaatttcaactcgtcaagtacatcacactccagtttgaaaagtccaagc
cacatggaaaaatacccgcaaaaagagaaaaccaaagaagatctggattcacgaagcaac
ctacacttgccagaaactaaattttctgaattgtcaaaactgaagaatgatgatatggaa
aaggctaatcatattgaaagtgttattaaatcaaacttgccaaactgtgcaaacagtgac
accgacttcatgggtcttttcaaatcaagccggtatgacccaagcatttctttttctgga
atgtcattatcagacacaatgacacttagaggaagtgtccaaaataaactcaatccccga
cctggaaaggtagtgatatatagtgaacccgacgtctctgagaagtgcattgaagttttc
agtgacattcaggattgcagttcttggagcctctctccagtgatactcataaaagttgtt
agaggatgttggattttgtatgagcaaccaaattttgaagggcactccatccccttagaa
gaaggagaattggaactctctggtctctggggtatagaagacattttggaaaggcacgaa
gaagcagagtctgataagccagtggtgattggttccatcagacatgtggttcaggattac
agagttagtcacattgacttatttactgaaccagaagggttaggaatcctaagttcctac
tttgatgatactgaagaaatgcagggatttggtgtaatgcagaagacttgttccatgaaa
gtacattggggcacgtggctgatttatgaagaacctggatttcagggtgttcctttcatc
ctggaacctggtgaataccctgacttgtccttctgggatacagaagaagcgtacattgga
tccatgcggcctctgaaaatgggtggccgtaaagttgaattccctacagatccaaaggta
gttgtttatgaaaagcctttctttgaaggaaaatgtgtggaactagaaacaggaatgtgt
agttttgtcatggagggaggtgaaacagaagaggcgactggagacgatcatttgccgttt
acgtcagtggggtctatgaaagttctaagaggcatttgggttgcatatgagaaacctgga
tttaccggtcatcagtatttgctagaagaaggagaatacagggactggaaagcctgggga
ggttacaatggagagcttcagtctttacgacctatattaggtgatttttcaaatgctcac
atgataatgtacagtgaaaaaaactttggatccaaaggttccagtattgatgtattggga
attgttgctaatttaaaggagactggatatggagtgaagacacagtctattaatgtactg
agtggagtatgggtagcctatgaaaatcctgacttcacaggagaacagtatatactggat
aaaggattttataccagttttgaggactggggaggcaaaaattgtaagatctcttctgtt
caacctatatgtttggattctttcactggcccaaggagacgaaatcagattcacttgttt
tcagaaccacagtttcaaggtcacagtcaaagttttgaagaaacaacaagtcaaattgat
gattcattttctaccaagtcttgcagagtttcaggaggcagctgggttgtatatgatgga
gaaaatttcactggtaatcaatacgtgttggaagaaggccattatccttgtctgtctgca
atgggatgcccgcctggagcaactttcaagtctcttcgttttatagatgttgaattttct
gaaccaacaattattctctttgaaagagaagacttcaaaggaaaaaagattgaacttaat
gcagaaactgtcaatctccgatccctgggattcaacacacaaatacgctctgttcaggtt
attggtggcatatgggttacttatgaatatggcagttacagagggcgacagttcctattg
tcacctgcagaagtacctaattggtatgaattcagtggctgtcgccaaataggttctcta
cgaccttttgttcagaagcgaatttatttcagacttcgaaacaaagcaacagggttattc
atgtcaaccaatggaaacttagaggatctgaagcttctgaggatacaggtcatggaggat
gtcggggccgatgatcagatttggatctatcaagaaggatgtatcaaatgcaggatagca
gaagactgctgcctgacgattgtgggcagcctggtaacatctggctccaagctaggcctg
gccctggaccagaatgctgacagccagttctggagcttgaagtccgatggcaggatttac
agcaagttgaagccaaatttagttttagacattaaagggggcacacagtatgatcaaaat
cacattatcctcaacactgtcagcaaagagaagtttacacaagtgtgggaagccatggtc
ctatatacctga

DBGET integrated database retrieval system