KEGG   Homo sapiens (human): 2020Help
Entry
2020              CDS       T01001                                 

Gene name
EN2
Definition
(RefSeq) engrailed homeobox 2
  KO
K09319  homeobox protein engrailed
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2020 (EN2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, En
    2020 (EN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Engrail_1_C_sig Homeobox_KN DUF2316 CENP-B_N
Motif
Other DBs
NCBI-GeneID: 2020
NCBI-ProteinID: NP_001418
OMIM: 131310
HGNC: 3343
Ensembl: ENSG00000164778
Vega: OTTHUMG00000151354
Pharos: P19622(Tbio)
UniProt: P19622
Position
7q36.3
AA seq 333 aa AA seqDB search
MEENDPKPGEAAAAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGNH
QHPHRITNFFIDNILRPEFGRRKDAGTCCAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQ
LLGSGSREPRQNPPCAPGAGGPLPAAGSDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGS
LKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWPAWVYCTRYSDRPSSGPRSRKPKKKNP
NKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIK
KATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaatgaccccaagcctggcgaagcagcggcggcggtggagggacagcggcag
ccggaatccagccccggcggcggctcgggcggcggcggcggtagcagcccgggcgaagcg
gacaccgggcgccggcgggctctgatgctgcccgcggtcctgcaggcgcccggcaaccac
cagcacccgcaccgcatcaccaacttcttcatcgacaacatcctgcggcccgagttcggc
cggcgaaaggacgcggggacctgctgtgcgggcgcgggaggaggaaggggcggcggagcc
ggcggcgaaggcggcgcgagcggtgcggagggaggcggcggcgcgggcggctcggagcag
ctcttgggctcgggctcccgagagccccggcagaacccgccatgtgcgcccggcgcgggc
gggccgctcccagccgccggcagcgactctccgggtgacggggaaggcggctccaagacg
ctctcgctgcacggtggcgccaagaaaggcggcgaccccggcggccccctggacgggtcg
ctcaaggcccgcggcttgggcggcggcgacctgtcggtgagctcggactcggacagctcg
caagccggcgccaacctgggcgcgcagcccatgctctggccggcgtgggtctactgtacg
cgctactcggaccggccttcttcaggtcccaggtctcgaaaaccaaagaagaagaacccg
aacaaagaggacaagcggccgcgcacggcctttaccgccgagcagctgcagaggctcaag
gccgagttccagaccaacaggtacctgacggagcagcggcgccagagcctggcgcaggag
ctgagcctcaacgagtcacagatcaagatttggttccagaacaagcgcgccaagatcaag
aaggccacgggcaacaagaacacgctggccgtgcacctcatggcacagggcttgtacaac
cactccaccacagccaaggagggcaagtcggacagcgagtag

DBGET integrated database retrieval system