KEGG   Homo sapiens (human): 2021Help
Entry
2021              CDS       T01001                                 

Gene name
ENDOG
Definition
(RefSeq) endonuclease G
  KO
K01173  endonuclease G, mitochondrial
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    2021 (ENDOG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    2021 (ENDOG)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    2021 (ENDOG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endonuclease_NS
Motif
Other DBs
NCBI-GeneID: 2021
NCBI-ProteinID: NP_004426
OMIM: 600440
HGNC: 3346
Ensembl: ENSG00000167136
Vega: OTTHUMG00000020763
Pharos: Q14249(Tbio)
UniProt: Q14249 E5KNL5
Position
9q34.11
AA seq 297 aa AA seqDB search
MRALRAGLTLASGAGLGAVVEGWRRRREDARAAPGLLGRLPVLPVAAAAELPPVPGGPRG
PGELAKYGLPGLAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGDGDRRECDFREDDS
VHAYHRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLE
KYSRSLTRSYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAGG
QIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGSK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgctgcgggccggcctgaccctggcgtcgggcgcggggctgggtgcggtcgtc
gagggctggcggcggcggcgggaggacgcgcgggcggcgccgggactgctgggccggctg
cccgtgctgcccgtggcggcggcagccgagttgccccctgtgcccgggggaccccgcggc
ccgggcgagctggccaagtacgggctgccggggctggcgcagctcaagagccgcgagtcg
tacgtgctgtgctacgacccgcgcacccgcggcgcgctctgggtggtggagcagctgcga
cccgagcgtctccgcggcgacggcgaccggcgcgagtgcgacttccgcgaggacgactcg
gtgcacgcgtaccaccgtgccaccaacgccgactaccgcggcagtggcttcgaccgcggt
cacctggccgccgccgccaaccaccgctggagccagaaggccatggacgacacgttctac
ctgagcaacgtcgcgccccaggtgccccacctcaaccagaatgcctggaacaacctggag
aaatatagccgcagcttgacccgcagctaccaaaacgtctatgtctgcacagggccactc
ttcctgcccaggacagaggctgatgggaaatcctacgtaaagtaccaggtcatcggcaag
aaccacgtggcagtgcccacacacttcttcaaggtgctgatcctggaggcagcaggtggg
caaattgagctccgcacctacgtgatgcccaacgcacctgtggatgaggccatcccactg
gagcgcttcctggtgcccatcgagagcattgagcgggcttcggggctgctctttgtgcca
aacatcctggcgcgggcaggcagcctcaaggccatcacggcgggcagtaagtga

KEGG   Homo sapiens (human): 23052Help
Entry
23052             CDS       T01001                                 

Gene name
ENDOD1
Definition
(RefSeq) endonuclease domain containing 1
  KO
K15049  endonuclease domain-containing 1 protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99984 Nucleotide metabolism
    23052 (ENDOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endonuclease_NS EMC3_TMCO1
Motif
Other DBs
NCBI-GeneID: 23052
NCBI-ProteinID: NP_055851
HGNC: 29129
Ensembl: ENSG00000149218
Vega: OTTHUMG00000167835
Pharos: O94919(Tdark)
UniProt: O94919
Position
11q21
AA seq 500 aa AA seqDB search
MGTARWLALGSLFALAGLLEGRLVGEEEAGFGECDKFFYAGTPPAGLAADSHVKICQRAE
GAERFATLYSTRDRIPVYSAFRAPRPAPGGAEQRWLVEPQIDDPNSNLEEAINEAEAITS
VNSLGSKQALNTDYLDSDYQRGQLYPFSLSSDVQVATFTLTNSAPMTQSFQERWYVNLHS
LMDRALTPQCGSGEDLYILTGTVPSDYRVKDKVAVPEFVWLAACCAVPGGGWAMGFVKHT
RDSDIIEDVMVKDLQKLLPFNPQLFQNNCGETEQDTEKMKKILEVVNQIQDEERMVQSQK
SSSPLSSTRSKRSTLLPPEASEGSSSFLGKLMGFIATPFIKLFQLIYYLVVAILKNIVYF
LWCVTKQVINGIESCLYRLGSATISYFMAIGEELVSIPWKVLKVVAKVIRALLRILCCLL
KAICRVLSIPVRVLVDVATFPVYTMGAIPIVCKDIALGLGGTVSLLFDTAFGTLGGLFQV
VFSVCKRIGYKVTFDNSGEL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgcgcgctggctcgcgctgggcagcctcttcgccctggctgggctgctggaa
ggccggctcgtgggcgaggaggaagccggctttggcgaatgtgacaagttcttctacgcc
gggaccccgcctgcggggctggcggccgattcccacgtgaagatctgtcagcgcgcggag
ggtgctgagcgcttcgccaccctctacagcacccgggaccgcatccccgtgtactccgcg
ttccgcgccccgcgccctgcgcccggcggcgccgagcagcgatggctggtggagccgcag
atcgatgaccccaacagcaaccttgaggaggcgattaatgaggcagaggccatcacctct
gtgaacagcctgggaagcaagcaagccttgaatacagattaccttgattctgattaccaa
agaggacagctttacccattctcccttagcagtgatgtccaggtggccacatttactctc
acaaattcagccccaatgactcagtccttccaggaacggtggtatgtgaatctccacagc
ctaatggaccgggctttgaccccacagtgtggcagtggggaagacctatatatcctcaca
ggcacagtgccctcagactacagagttaaagacaaagtggcagtccctgagtttgtttgg
ctggcagcctgttgtgctgtccctggaggaggctgggccatgggctttgtcaagcacacc
cgggacagtgacatcatagaagatgtgatggtaaaagatcttcagaaactgcttccattt
aaccctcagctgtttcagaacaactgtggtgaaactgagcaagacacagagaaaatgaaa
aaaatcctggaagtggttaaccaaatccaggatgaagaacgaatggtacaatctcaaaag
agttctagtcccctttctagcaccaggagcaagaggtctactctgttgcctccagaggca
tctgagggaagtagtagctttttgggaaaactcatgggcttcattgctaccccattcatc
aagctttttcaattaatttattaccttgtggtagcaatcctgaagaacattgtctatttc
ctgtggtgtgttaccaagcaggtgattaatggcatagaaagttgcctttaccgcctgggc
tcagccaccatctcatacttcatggccattggggaagagttggtgagcattccctggaag
gtgctcaaggtcgtggccaaagtcatcagggctctcctccggatcctttgttgtctgctg
aaggccatttgccgagttctgagcatccctgtccgtgtccttgtggatgtggccactttc
cctgtgtacaccatgggcgctattccaattgtttgcaaggacattgcactgggccttggt
ggcactgtctcactgctctttgacactgcttttggtaccctgggtggcctatttcaggtg
gtttttagtgtctgcaagcggattggctacaaggttacttttgacaattctggggagtta
taa

KEGG   Homo sapiens (human): 9941Help
Entry
9941              CDS       T01001                                 

Gene name
EXOG, ENDOGL1, ENDOGL2, ENGL, ENGL-a, ENGL-b, ENGLA, ENGLB
Definition
(RefSeq) exo/endonuclease G
  KO
K15050  nuclease EXOG, mitochondrial
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    9941 (EXOG)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    9941 (EXOG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endonuclease_NS Exog_C
Motif
Other DBs
NCBI-GeneID: 9941
NCBI-ProteinID: NP_005098
OMIM: 604051
HGNC: 3347
Ensembl: ENSG00000157036
Vega: OTTHUMG00000131295
Pharos: Q9Y2C4(Tbio)
UniProt: Q9Y2C4
Structure
PDB: 

Position
3p22.2
AA seq 368 aa AA seqDB search
MAIKSIASRLRGSRRFLSGFVAGAVVGAAGAGLAALQFFRSQGAEGALTGKQPDGSAEKA
VLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHISKSKIMGDADRKHCKFKPDPNI
PPTFSAFNEDYVGSGWSRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEM
YCRELTERFEDVWVVSGPLTLPQTRGDGKKIVSYQVIGEDNVAVPSHLYKVILARRSSVS
TEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDTCK
LLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQS
GTQIRKPS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaagagtatcgcttcccgcctccggggttcccgtcgttttctgagcggcttc
gtggctggggctgtagtgggcgctgcgggagctgggctcgcggccctgcagttcttccgg
agtcagggcgctgagggagcgttgacagggaagcagccggatggatctgcagaaaaggct
gtcttggaacaatttggattccctttaactggaacagaggcaaggtgttacactaatcac
gctttgtcttatgatcaggcaaagcgggtgcctagatgggttcttgaacatatttccaaa
agcaagataatgggtgatgcagacagaaagcattgtaaatttaagcctgatcccaatatc
cctccaaccttcagtgccttcaatgaagattatgttggaagtgggtggtcacgaggacac
atggctccagcaggaaataacaaattttcaagtaaagccatggctgaaaccttttacctt
tctaacattgtgcctcaggattttgataataattctggatattggaacagaatagaaatg
tactgtcgagagctgacagaaaggtttgaagatgtttgggtggtatctgggcctttgacc
ttacctcagactagaggcgatggaaagaaaatagttagttaccaggtgattggcgaggac
aacgtggcagtcccctcacacctttataaggtaatcctggcccgcagaagctcagtatct
accgaaccactggcgctaggggcctttgtggtacccaatgaagccatcggcttccagccc
cagttaactgaattccaagtgagcctccaggacctagagaagttgtcaggactggtgttt
tttcctcatttggatagaactagtgatatccggaatatctgctctgtggacacctgtaag
ctcctggatttccaggagttcaccttgtacttgagtacaagaaagattgaaggagcccga
tcagtgctcagactggaaaagatcatggaaaacttgaagaatgcagagattgaaccagat
gattactttatgagtcgctatgagaagaagctagaagaactcaaagctaaggagcagtca
ggaacccagataagaaagccatcctag

DBGET integrated database retrieval system