KEGG   Homo sapiens (human): 2026Help
Entry
2026              CDS       T01001                                 

Gene name
ENO2, HEL-S-279, NSE
Definition
(RefSeq) enolase 2
  KO
K01689  enolase [EC:4.2.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa03018  RNA degradation
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    2026 (ENO2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    2026 (ENO2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    2026 (ENO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hsa03019]
    2026 (ENO2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2026 (ENO2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     2026 (ENO2)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     2026 (ENO2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2026 (ENO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-GeneID: 2026
NCBI-ProteinID: NP_001966
OMIM: 131360
HGNC: 3353
Ensembl: ENSG00000111674
Vega: OTTHUMG00000168967
Pharos: P09104(Tbio)
UniProt: P09104 Q6FHV6
Structure
PDB: 

Position
12p13.31
AA seq 434 aa AA seqDB search
MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGK
GVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCK
AGAAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRD
AMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKI
VIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDD
WAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLA
QENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
ARFAGHNFRNPSVL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtccatagagaagatctgggcccgggagatcctggactcccgcgggaaccccacagtg
gaggtggatctctatactgccaaaggtcttttccgggctgcagtgcccagtggagcctct
acgggcatctatgaggccctggagctgagggatggagacaaacagcgttacttaggcaaa
ggtgtcctgaaggcagtggaccacatcaactccaccatcgcgccagccctcatcagctca
ggtctctctgtggtggagcaagagaaactggacaacctgatgctggagttggatgggact
gagaacaaatccaagtttggggccaatgccatcctgggtgtgtctctggccgtgtgtaag
gcaggggcagctgagcgggaactgcccctgtatcgccacattgctcagctggccgggaac
tcagacctcatcctgcctgtgccggccttcaacgtgatcaatggtggctctcatgctggc
aacaagctggccatgcaggagttcatgatcctcccagtgggagctgagagctttcgggat
gccatgcgactaggtgcagaggtctaccatacactcaagggagtcatcaaggacaaatac
ggcaaggatgccaccaatgtgggggatgaaggtggctttgcccccaatatcctggagaac
agtgaagccttggagctggtgaaggaagccatcgacaaggctggctacacggaaaagatc
gttattggcatggatgttgctgcctcagagttttatcgtgatggcaaatatgacttggac
ttcaagtctcccactgatccttcccgatacatcactggggaccagctgggggcactctac
caggactttgtcagggactatcctgtggtctccattgaggacccatttgaccaggatgat
tgggctgcctggtccaagttcacagccaatgtagggatccagattgtgggtgatgacctg
acagtgaccaacccaaaacgtattgagcgggcagtggaagaaaaggcctgcaactgtctg
ctgctcaaggtcaaccagatcggctcggtcactgaagccatccaagcgtgcaagctggcc
caggagaatggctggggggtcatggtgagtcatcgctcaggagagactgaggacacattc
attgctgacctggtggtggggctgtgcacaggccagatcaagactggtgccccgtgccgt
tctgaacgtctggctaaatacaaccagctcatgagaattgaggaagagctgggggatgaa
gctcgctttgccggacataacttccgtaatcccagtgtgctgtga

DBGET integrated database retrieval system