KEGG   Homo sapiens (human): 202865
Entry
202865            CDS       T01001                                 
Symbol
C7orf33
Name
(RefSeq) chromosome 7 open reading frame 33
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF5548
Other DBs
NCBI-GeneID: 202865
NCBI-ProteinID: NP_660347
HGNC: 21724
Ensembl: ENSG00000170279
Pharos: Q8WU49(Tdark)
UniProt: Q8WU49 A0A090N8Y1
Position
7:148590766..148615860
AA seq 177 aa
MQVEVQSLSLEECPWRLPGPQCECEALLPSGARRRIDLRLSGRAVAVWVHVRGGPGQFNL
SYATGRHKKPNPHQNMNRGMEFIAPVSAPTKSGAPWHFLSQGPTDAQRAVRIRPGTRMGL
SSDPVVGTLSSSYLDLLTLSYKPGRTVTSSYLNVRGHEVRKLQNSVEATRISRTDSS
NT seq 534 nt   +upstreamnt  +downstreamnt
atgcaagtggaagttcaaagcctcagccttgaagagtgtccctggagacttccaggcccc
caatgtgaatgtgaagccctcctgcccagtggggcaaggcgccggattgaccttcgcctg
agtgggagggcagtcgctgtttgggtccacgttaggggcggtccaggtcaatttaacttg
tcatatgccacgggaagacataagaagccaaacccacaccaaaacatgaaccgggggatg
gaatttattgctcctgtatcagctcccaccaaatctggtgccccgtggcattttctttct
caaggtcccacggatgcccagagagcagtcagaatcaggccaggcaccaggatgggcttg
tcctcagatccagttgtcggcaccttgtcttccagttacctagatctgctaactctctct
tacaagcctgggaggacagtgacaagttcatacctaaacgtacgtgggcatgaagtaaga
aagctccagaattctgttgaggccacaaggatttccagaactgacagcagttaa

DBGET integrated database retrieval system