KEGG   Homo sapiens (human): 203Help
Entry
203               CDS       T01001                                 

Gene name
AK1, HTL-S-58j
Definition
(RefSeq) adenylate kinase 1
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00730  Thiamine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Disease
H00674  Anemia due to disorders of nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    203 (AK1)
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    203 (AK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     203 (AK1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   203 (AK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 AAA_33 AAA_18 Thymidylate_kin dNK Zeta_toxin Cytidylate_kin AAA_19 AAA_22 NTPase_1 AAA
Motif
Other DBs
NCBI-GeneID: 203
NCBI-ProteinID: NP_000467
OMIM: 103000
HGNC: 361
Ensembl: ENSG00000106992
Vega: OTTHUMG00000020722
Pharos: P00568(Tbio)
UniProt: P00568 Q6FGX9
Structure
PDB: 

Position
9q34.11
AA seq 194 aa AA seqDB search
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEI
MEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDA
GPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVD
SVFSQVCTHLDALK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaagctgaagaaaaccaagatcatctttgtggtgggtgggcctggctcaggg
aagggcacccagtgtgagaagatcgtgcagaagtatggctacacccacctctccaccggg
gacctcctgcggtccgaggtcagctcaggctcggccaggggcaagaagctgtcggaaatc
atggagaaggggcagctggttccactggagacagtgttggacatgctccgggatgccatg
gtggccaaagtcaatacttccaaaggcttcctgattgatggctacccgcgggaggtgcag
caaggagaagagtttgagcgacggattggacagcccacactgctgctgtatgtggacgca
ggccctgagaccatgacccagcggctcttgaaacgtggagagaccagcgggcgtgtggac
gacaatgaggagaccatcaaaaagcggctggagacctattacaaggccacagaacccgtc
atcgccttctatgagaaacgtggcattgtgcgcaaggtcaacgctgagggctccgtggac
agtgtcttctcccaggtctgcacccacctggacgccctaaagtag

DBGET integrated database retrieval system