KEGG   Homo sapiens (human): 203074
Entry
203074            CDS       T01001                                 

Gene name
PRSS55, CT153, T-SP1, TSP1, UNQ9391
Definition
(RefSeq) serine protease 55
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 203074
NCBI-ProteinID: NP_940866
OMIM: 615144
HGNC: 30824
Ensembl: ENSG00000184647
Vega: OTTHUMG00000129345
Pharos: Q6UWB4(Tdark)
UniProt: Q6UWB4
Position
8p23.1
AA seq 352 aa
MLLFSVLLLLSLVTGTQLGPRTPLPEAGVAILGRARGAHRPQPPHPPSPVSECGDRSIFE
GRTRYSRITGGMEAEVGEFPWQVSIQARSEPFCGGSILNKWWILTAAHCLYSEELFPEEL
SVVLGTNDLTSPSMEIKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQ
PGPATWRECWVAGWGQTNAADKNSVKTDLMKAPMVIMDWEECSKMFPKLTKNMLCAGYKN
ESYDACKGDSGGPLVCTPEPGEKWYQVGIISWGKSCGEKNTPGIYTSLVNYNLWIEKVTQ
LEGRPFNAEKRRTSVKQKPMGSPVSGVPEPGSPRSWLLLCPLSHVLFRAILY
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgctcctgttctcagtgttgctgctcctgtccctggtcacgggaactcagctcggtcca
cggactcctctcccagaggctggagtggctatcctaggcagggctaggggagcccaccgc
cctcagccccctcatccccccagcccagtcagtgaatgtggtgacagatctattttcgag
ggaagaactcggtattccagaatcacaggggggatggaggcggaggtgggtgagtttccg
tggcaggtgagtattcaggcaagaagtgaacctttctgtggcggctccatcctcaacaag
tggtggattctcactgcggctcactgcttatattccgaggagctgtttccagaagaactg
agtgtcgtgctggggaccaacgacttaactagcccatccatggaaataaaggaggtcgcc
agcatcattcttcacaaagactttaagagagccaacatggacaatgacattgccttgctg
ctgctggcttcgcccatcaagctcgatgacctgaaggtgcccatctgcctccccacgcag
cccggccctgccacatggcgcgaatgctgggtggcaggttggggccagaccaatgctgct
gacaaaaactctgtgaaaacggatctgatgaaagcgccaatggtcatcatggactgggag
gagtgttcaaagatgtttccaaaacttaccaaaaatatgctgtgtgccggatacaagaat
gagagctatgatgcctgcaagggtgacagtggggggcctctggtctgcaccccagagcct
ggtgagaagtggtaccaggtgggcatcataagctggggaaagagctgtggagagaagaac
accccagggatatacacctcgttggtgaactacaacctctggatcgagaaagtgacccag
ctagagggcaggcccttcaatgcagagaaaaggaggacttctgtcaaacagaaacctatg
ggctccccagtctcgggagtcccagagccaggcagccccagatcctggctcctgctctgt
cccctgtcccatgtgttgttcagagctattttgtactga

DBGET integrated database retrieval system