KEGG   Homo sapiens (human): 203102Help
Entry
203102            CDS       T01001                                 

Gene name
ADAM32
Definition
(RefSeq) ADAM metallopeptidase domain 32
  KO
K16070  disintegrin and metalloproteinase domain-containing protein 32 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    203102 (ADAM32)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     203102 (ADAM32)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   203102 (ADAM32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin ADAM_CR Pep_M12B_propep Disintegrin Reprolysin_5 Reprolysin_3 DUF2561 MAP17 DUF4834
Motif
Other DBs
NCBI-GeneID: 203102
NCBI-ProteinID: NP_659441
OMIM: 618602
HGNC: 15479
Ensembl: ENSG00000197140
Vega: OTTHUMG00000164071
Pharos: Q8TC27(Tdark)
UniProt: Q8TC27 A0A140VJD9
Position
8p11.22
AA seq 787 aa AA seqDB search
MFRLWLLLAGLCGLLASRPGFQNSLLQIVIPEKIQTNTNDSSEIEYEQISYIIPIDEKLY
TVHLKQRYFLADNFMIYLYNQGSMNTYSSDIQTQCYYQGNIEGYPDSMVTLSTCSGLRGI
LQFENVSYGIEPLESAVEFQHVLYKLKNEDNDIAIFIDRSLKEQPMDDNIFISEKSEPAV
PDLFPLYLEMHIVVDKTLYDYWGSDSMIVTNKVIEIVGLANSMFTQFKVTIVLSSLELWS
DENKISTVGEADELLQKFLEWKQSYLNLRPHDIAYLLIYMDYPRYLGAVFPGTMCITRYS
AGVALYPKEITLEAFAVIVTQMLALSLGISYDDPKKCQCSESTCIMNPEVVQSNGVKTFS
SCSLRSFQNFISNVGVKCLQNKPQMQKKSPKPVCGNGRLEGNEICDCGTEAQCGPASCCD
FRTCVLKDGAKCYKGLCCKDCQILQSGVECRPKAHPECDIAENCNGTSPECGPDITLING
LSCKNNKFICYDGDCHDLDARCESVFGKGSRNAPFACYEEIQSQSDRFGNCGRDRNNKYV
FCGWRNLICGRLVCTYPTRKPFHQENGDVIYAFVRDSVCITVDYKLPRTVPDPLAVKNGS
QCDIGRVCVNRECVESRIIKASAHVCSQQCSGHGVCDSRNKCHCSPGYKPPNCQIRSKGF
SIFPEEDMGSIMERASGKTENTWLLGFLIALPILIVTTAIVLARKQLKKWFAKEEEFPSS
ESKSEGSTQTYASQSSSEGSTQTYASQTRSESSSQADTSKSKSEDSAEAYTSRSKSQDST
QTQSSSN
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcctctggttgctgctggccgggctctgcggcctcctggcgtcaagacccggt
tttcaaaattcacttctacagatcgtaattccagagaaaatccaaacaaatacaaatgac
agttcagaaatagaatatgaacaaatatcctatattattccaatagatgagaaactgtac
actgtgcaccttaaacaaagatattttttagcagataattttatgatctatttgtacaat
caaggatctatgaatacttattcttcagatattcagactcaatgctactatcaaggaaat
attgaaggatatccagattccatggtcacactcagcacgtgctctggactaagaggaata
ctgcaatttgaaaatgtttcttatggaattgagcctctggaatctgcagttgaatttcag
catgttctttacaaattaaagaatgaagacaatgatattgcaatttttattgacagaagc
ctgaaagaacaaccaatggatgacaacatttttataagtgaaaaatcagaaccagctgtt
ccagatttatttcctctttatctagaaatgcatattgtggtggacaaaactttgtatgat
tactggggctctgatagcatgatagtaacaaataaagtcatcgaaattgttggccttgca
aattcaatgttcacccaatttaaagttactattgtgctgtcatcattggagttatggtca
gatgaaaataagatttctacagttggtgaggcagatgaattattgcaaaaatttttagaa
tggaaacaatcttatcttaacctaaggcctcatgatattgcatatctactaatttatatg
gattatcctcgttatttgggagcagtgtttcctggaacaatgtgtattactcgttattct
gcaggagttgcattgtaccccaaggagataactctggaggcatttgcagttattgtcacc
cagatgctggcactcagtctgggaatatcatatgacgacccaaagaaatgtcaatgttca
gaatccacctgtataatgaatccagaagttgtgcaatccaatggtgtgaagacttttagc
agttgcagtttgaggagctttcaaaatttcatttcaaatgtgggtgtcaaatgtcttcag
aataagccacaaatgcaaaaaaaatctccgaaaccagtctgtggcaatggcagattggag
ggaaatgaaatctgtgattgtggtactgaggctcaatgtggacctgcaagctgttgtgat
tttcgaacttgtgtactgaaagacggagcaaaatgttataaaggactgtgctgcaaagac
tgtcaaattttacaatcaggcgttgaatgtaggccgaaagcacatcctgaatgtgacatc
gctgaaaattgtaatggaacctcaccagaatgtggtcctgacataactttaatcaatgga
ctttcatgcaaaaataataagtttatttgttatgacggagactgccatgatctcgatgca
cgttgtgagagtgtatttggaaaaggttcaagaaatgctccatttgcctgctatgaagaa
atacaatctcaatcagacagatttgggaactgtggtagggatagaaataacaaatatgtg
ttctgtggatggaggaatcttatatgtggaagattagtttgtacctaccctactcgaaag
cctttccatcaagaaaatggtgatgtgatttatgctttcgtacgagattctgtatgcata
actgtagactacaaattgcctcgaacagttccagatccactggctgtcaaaaatggctct
cagtgtgatattgggagggtttgtgtaaatcgtgaatgtgtagaatcaaggataattaag
gcttcagcacatgtttgttcacaacagtgttctggacatggagtgtgtgattccagaaac
aagtgccattgttcgccaggctataagcctccaaactgccaaatacgttccaaaggattt
tccatatttcctgaggaagatatgggttcaatcatggaaagagcatctgggaagactgaa
aacacctggcttctaggtttcctcattgctcttcctattctcattgtaacaaccgcaata
gttttggcaaggaaacagttgaaaaagtggttcgccaaggaagaggaattcccaagtagc
gaatctaaatcggaaggtagcacacagacatatgccagccaatccagctcagaaggcagc
actcagacatatgccagccaaaccagatcagaaagcagcagtcaagctgatactagcaaa
tccaaatcagaagatagtgctgaagcatatactagcagatccaaatcacaggacagtacc
caaacacaaagcagtagtaactag

DBGET integrated database retrieval system