KEGG   Homo sapiens (human): 203238
Entry
203238            CDS       T01001                                 
Symbol
CCDC171, C9orf93, bA536D16.1, bA778P13.1
Name
(RefSeq) coiled-coil domain containing 171
Organism
hsa  Homo sapiens (human)
SSDB
Other DBs
NCBI-GeneID: 203238
NCBI-ProteinID: NP_775821
HGNC: 29828
Ensembl: ENSG00000164989
Pharos: Q6TFL3(Tdark)
UniProt: Q6TFL3
Position
9:15552885..16108926
AA seq 1326 aa
MNLNTSSNTGDTQRLKIASLDVKQILKNETELDITDNLRKKLHWAKKEKLEITTKHNAEL
ASYESQIAKLRSEVEKGEALRQSLEYDLAVARKEAGLGRRAAEERLAEAHRIQEKLCAQN
SELQAKTNETEKAFQTSQQKWKEECRRFEHDLEERDNMIQNCNREYDLLMKEKSRLEKTL
QEALEKHQREKNEMESHIRETALEEFRLQEEQWEAERRELQFIVQEQDTAVQNMHKKVEK
LETEHMDCSDLLRRQTSELEFSTQREERLRKEFEATTLRVRKLEENIEAERAAHLESKFN
SEIIQLRIRDLEGALQVEKASQAEAVADLEIIKNEFKEVESAYEREKHNAQESFAKLNLL
EKEYFSKNKKLNEDIEEQKKVIIDLSKRLQYNEKSCSELQEELVMAKKHQAFLVETCENN
VKELESILDSFTVSGQWTSGIHKDKDKPPSFSVVLERLRRTLTDYQNKLEDASNEEKACN
ELDSTKQKIDSHTKNIKELQDKLADVNKELSHLHTKCADREALISTLKVELQNVLHCWEK
EKAQAAQSESELQKLSQAFHKDAEEKLTFLHTLYQHLVAGCVLIKQPEGMLDKFSWSELC
AVLQENVDALIADLNRANEKIRHLEYICKNKSDTMRELQQTQEDTFTKVAEQIKAQESCW
HRQKKELELQYSELFLEVQKRAQKFQEIAEKNMEKLNHIEKSHEQLVLENSHFKKLLSQT
QREQMSLLAACALMAGALYPLYSRSCALSTQRDFLQEQVNTFELFKLEIRTLAQALSTVE
EKKQEEAKMKKKTFKGLIRIFRKGVIAVLAANRLKILGQSCASLFTWMESFKEGIGMLVC
TGEPQDKHKFPKHQKEQLRCLQALSWLTSSDLLAAIISSMAELQDVIGKADPNSRICGHL
LIGAAKNSFAKLMDKISLVMECIPLHSSRSITYVEKDSLVQRLAHGLHKVNTLALKYGLR
GHVPITKSTASLQKQILGFTQRLHAAEVERRSLRLEVTEFKRSVNEMKKELDKAQGLQMQ
LNEFKQSKLITHEKFESACEELNNALLREEQAQMLLNEQAQQLQELNYKLELHSSEEADK
NQTLGEAVKSLSEAKMELRRKDQSLRQLNRHLTQLEQDKRRLEENIHDAESALRMAAKDK
ECVANHMRAVENTLHKVRDQISLSWSAASRNDFTLQLPKLHLETFAMEGLKGGPEVVACQ
AMIKSFMDVYQLASTRIMTLEKEMTSHRSHIAALKSELHTACLRENASLQSIGSRDHSNL
SIPSRAPLPADTTGIGDFLPLKAELDTTYTFLKETFINTVPHALTSSHSSPVTMSANANR
PTQIGL
NT seq 3981 nt   +upstreamnt  +downstreamnt
atgaatttgaatacttcaagtaatactggtgatacccaaaggttgaagattgcctcattg
gatgtaaaacaaatacttaaaaatgaaacagagttggatattactgataatctcaggaag
aaactccattgggctaaaaaagaaaagttagaaataacaaccaaacacaatgcagagctg
gcaagctatgagagccagattgccaagctacggtccgaggttgaaaagggagaagcattg
cgacaaagtctggaatatgacctagctgttgctagaaaggaagctggtcttggaagacgg
gctgctgaagaaagattagccgaggcacataggatccaagaaaaactctgtgcacagaat
tcagaacttcaagcaaagacaaatgagactgagaaagcatttcagacttctcagcaaaaa
tggaaagaagaatgcagaagatttgaacatgatttggaggaaagagacaatatgatccaa
aattgcaatcgagaatatgatttacttatgaaagaaaaaagcagactagagaaaactcta
caggaagcgttggaaaaacatcaacgggagaagaatgagatggagtctcatatcagggag
acagcattggaggagtttagattacaagaagaacaatgggaagcagaaagaagagaatta
caatttatagtacaggagcaagatactgctgtgcaaaatatgcataagaaagtagaaaaa
ttagaaacagaacatatggactgctctgaccttttacggcgacaaacaagtgaacttgaa
tttagcactcaacgagaggaacgccttagaaaagaatttgaggcaactactctaagagtg
aggaaattagaagaaaacattgaagcagaaagagcagcgcatttggaatcaaaatttaat
tctgaaattattcagttacggattcgagaccttgaaggagctttgcaagtagagaaggcc
agtcaagcagaagctgttgctgatttggaaattatcaagaatgaattcaaagaagttgaa
agtgcatatgagcgagaaaagcataatgcacaagagagctttgcaaaactaaatttatta
gaaaaagagtatttctccaaaaataagaaactaaatgaagacatcgaggaacagaagaaa
gtaattatagacctttcaaagagactccagtataatgaaaaaagttgcagtgaattacag
gaagaactagtaatggctaagaagcaccaggccttcctagtagagacatgtgaaaataac
gtgaaagaattggaatcgatcttggacagctttactgtgtcgggccagtggacatcaggc
atccacaaggacaaagataaacctcccagcttctctgttgtccttgagagattgaggcgt
accttgacagattaccagaacaagctggaagatgcatctaatgaggaaaaggcatgtaat
gaacttgattctacgaaacagaagatagactctcacactaaaaatataaaggaacttcag
gataaactggctgatgttaataaagagttaagtcatttacacactaaatgtgcagaccga
gaggctttaataagcactttaaaagtggaactacaaaatgtgctgcactgttgggagaaa
gaaaaggctcaggcagcccagtctgaaagtgaactgcagaagctttcccaggctttccat
aaggatgcagaggagaagctaaccttccttcacaccttatatcagcacttggtagcaggc
tgtgtgctcataaaacaaccagaaggcatgctggataaattctcttggtctgagctttgt
gcagtcttacaggagaatgttgatgccctgattgcagacctcaacagggctaatgagaag
ataaggcatctagagtatatctgtaaaaacaagtctgacacgatgagagagcttcagcag
actcaggaagacacctttaccaaagtggcagaacagatcaaagcccaagagagctgctgg
cacagacaaaagaaggaactagagctgcagtattctgaactcttcctggaggtgcagaag
agggcacagaaatttcaagaaattgctgaaaaaaacatggaaaaattgaaccatattgag
aagtcacatgaacagttggttcttgaaaattcgcacttcaaaaaactgttatcacagact
caaagggaacagatgtccttgctggcagcctgtgcattaatggctggtgccttatatccc
ctctatagccgatcatgcgccttgtctacacagagagattttctccaggagcaggtcaac
acctttgagttgttcaaactggaaattagaactctagcccaggctttgtcaactgtagag
gaaaagaagcaagaggaagccaagatgaaaaagaaaacattcaaaggattgatacgtata
tttcggaaaggtgttattgctgttttggcagcaaacagactcaagattttgggccaatca
tgtgcctctctttttacctggatggagagtttcaaagaaggcataggcatgttagtgtgc
acaggagagccccaagacaagcataaatttccaaaacatcaaaaggagcagttgcgttgt
ttacaagcgctcagttggctcaccagttctgaccttcttgctgcaataatcagttctatg
gctgaattacaagacgtcattggtaaagcagatccaaattccagaatttgtggacattta
ctcataggtgcagccaagaattcttttgcaaaactcatggataaaattagtctggtaatg
gaatgtatacctctgcacagtagcaggagtattacatatgtagaaaaagattccctggtt
cagaggctggcccatggacttcataaagtaaacacactggccctgaaatatggtttgcgt
ggccatgtgcccattacgaaaagcacagcatcgttgcagaagcaaatacttggatttaca
caaagactgcatgctgcagaagtggagcgccgctcactacgcttagaggtcacagaattc
aaacgaagtgtgaatgaaatgaaaaaggagcttgacaaagcccagggtctgcaaatgcaa
ttaaatgaatttaagcagtctaaattgatcacccatgagaagtttgaaagtgcatgtgaa
gaactaaataatgcattacttcgggaagagcaggcacaaatgctattgaatgaacaggca
caacaactacaggaattgaattataaacttgaattgcactccagtgaggaagctgacaaa
aaccaaactcttggagaagctgttaagagtctctccgaggcaaagatggagctgagaaga
aaagatcaatctctgcgtcagctcaatagacatcttacccagctggagcaggacaagcgt
cgactggaggagaacatccatgatgcagagagtgccctccgcatggcagccaaagacaaa
gaatgtgttgctaatcacatgagagcagtagaaaatacgcttcacaaggtcagagatcag
atctcgctgtcatggtctgcggcaagtaggaatgacttcaccctacagctacccaaactg
cacctggagacctttgcaatggaggggctcaagggcgggccagaggtggtagcatgccag
gctatgattaaaagtttcatggatgtctaccagcttgcaagcactagaatcatgacatta
gagaaggaaatgacatctcatcgaagtcacattgcagccttgaaatcagaacttcacaca
gcttgtttacgtgaaaatgcaagtttacaatcaataggatcacgagaccattcaaatctc
tccattccttcaagagctcctcttcctgctgacacaactggtattggggatttcttacca
ttgaaagctgaacttgatactacttacactttcttaaaggagacatttataaatactgtg
ccccatgctctgacatcatctcactcctctccagtgactatgtctgctaatgccaacaga
ccaactcagattggattatga

DBGET integrated database retrieval system