KEGG   Homo sapiens (human): 203260Help
Entry
203260            CDS       T01001                                 

Gene name
CCDC107, PSEC0222
Definition
(RefSeq) coiled-coil domain containing 107
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RIC3 RskA HrpB7 GAS DASH_Hsk3 DUF948
Motif
Other DBs
NCBI-GeneID: 203260
NCBI-ProteinID: NP_777583
HGNC: 28465
Ensembl: ENSG00000159884
Vega: OTTHUMG00000019868
Pharos: Q8WV48(Tdark)
UniProt: Q8WV48
Position
9p13.3
AA seq 283 aa AA seqDB search
MAGAVSLLGVVGLLLVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRER
TRAGSLPLGALYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQT
EQHLNNLMAQLDPLFERVTTLAGAQQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGG
ESAGGGDKVSETGTFLISPHTEASRPLPEDFCLKEDEEEIGDSQAWEEPTNWSTETWNLA
TSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQSLFS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcagtttcgctcttgggtgtggtggggctgctgcttgtgtctgcgctgtcc
ggggtcctaggagaccgcgccaatcccgacctccgggcacacccagggaacgcagcccac
cccggctctggagccacggaaccccggcggcgaccaccgctcaaggatcaacgcgagcgg
acccgggccgggtcgctgcctctgggggcgctgtacaccgcggccgtcgcggcttttgtg
ctgtacaagtgtttgcaggggaaagatgaaactgcggttctccacgaggaggcaagcaag
cagcagccactgcagtcagagcaacagctggcccagttgacacaacagctggcccagaca
gagcagcacctgaacaacctgatggcccagctggaccccctttttgagcgtgtgactact
ctggctggagcccagcaggagcttctgaacatgaagctatggaccatccacgagctgctg
caagatagcaagccggacaaggatatggaggcttcagaaccaggtgaaggctcgggaggc
gagtctgctggaggtggagacaaagtctctgaaactggaacattcctgatctctccccac
acagaggccagcagacctcttcctgaggacttctgtttaaaggaggacgaggaggagatt
ggtgacagtcaggcctgggaggagcccacaaactggagcacagagacatggaacctagct
acttcctgggaggtggggcggggactacggagaaggtgcagccaggctgtggcaaagggc
cccagtcacagccttggctgggaaggagggacgacagctgaaggtcgactaaaacaaagt
ctgttttcatga

DBGET integrated database retrieval system