KEGG   Homo sapiens (human): 203286
Entry
203286            CDS       T01001                                 
Symbol
ANKS6, ANKRD14, NPHP16, PKDR1, SAMD6
Name
(RefSeq) ankyrin repeat and sterile alpha motif domain containing 6
  KO
K21415  ankyrin repeat and SAM domain-containing protein 6
Organism
hsa  Homo sapiens (human)
Disease
H00537  Nephronophthisis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    203286 (ANKS6)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   203286 (ANKS6)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5 SAM_1 SAM_2 DUF515
Other DBs
NCBI-GeneID: 203286
NCBI-ProteinID: NP_775822
OMIM: 615370
HGNC: 26724
Ensembl: ENSG00000165138
Pharos: Q68DC2(Tbio)
UniProt: Q68DC2 B3KXP1
Structure
Position
9:complement(98732009..98796555)
AA seq 871 aa
MGEGGLPPAFQLLLRACDQGDTETARRLLEPGAAEPAERGAEPEAGAEPAGAEVAGPGAA
AAGAVGAPVPVDCSDEAGNTALQFAAAGGHEPLVRFLLRRGASVNSRNHYGWSALMQAAR
FGHVSVAHLLLDHGADVNAQNRLGASVLTVASRGGHLGVVKLLLEAGAFVDHHHPSGEQL
GLGGSRDEPLDITALMAAIQHGHEAVVRLLMEWGADPNHAARTVGWSPLMLAALTGRLGV
AQQLVEKGANPDHLSVLEKTAFEVALDCKHRDLVDYLDPLTTVRPKTDEEKRRPDIFHAL
KMGNFQLVKEIADEDPSHVNLVNGDGATPLMLAAVTGQLALVQLLVERHADVDKQDSVHG
WTALMQATYHGNKEIVKYLLNQGADVTLRAKNGYTAFDLVMLLNDPDTELVRLLASVCMQ
VNKDKGRPSHQPPLPHSKVRQPWSIPVLPDDKGGLKSWWNRMSNRFRKLKLMQTLPRGLS
SNQPLPFSDEPEPALDSTMRAAPQDKTSRSALPDAAPVTKDNGPGSTRGEKEDTLLTTML
RNGAPLTRLPSDKLKAVIPPFLPPSSFELWSSDRSRTRHNGKADPMKTALPQRASRGHPV
GGGGTDTTPVRPVKFPSLPRSPASSANSGNFNHSPHSSGGSSGVGVSRHGGELLNRSGGS
IDNVLSQIAAQRKKAAGLLEQKPSHRSSPVGPAPGSSPSELPASPAGGSAPVGKKLETSK
RPPSGTSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTG
ILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRE
RQILQETIHNFHSSFESSASNTRAPGNSPCA
NT seq 2616 nt   +upstreamnt  +downstreamnt
atgggcgagggcgggctgcccccggccttccagctgctgctgcgcgcgtgtgaccagggc
gacacggagacggcgcggcggctgctggagccgggggcggcggagccagccgagcgcggc
gcggagccggaggcgggcgcggagccggcgggggccgaggtggccgggcccggggccgca
gcggcgggggcagtcggggctccggtgcccgtggattgctcggacgaggcgggcaacacc
gcactgcagttcgccgcggccgggggccacgaaccgctggtgcgcttcctgctgcgccgc
ggtgcctcggtcaacagccgcaaccactacggctggagcgcgctcatgcaggcggccaga
tttgggcatgtgagtgtggcacacctcctgttggatcacggggctgatgtcaatgcccag
aaccggctgggggccagtgtgctcactgtggcttctcggggcggccacctgggtgtggtg
aagctgctcctggaagccggtgcctttgtggaccatcaccacccttcaggcgagcaactg
gggttgggcggcagcagggatgagcccttggacatcacagccctgatggctgccatccag
cacgggcacgaggccgtggtgcgtctactgatggagtggggcgcggaccccaaccacgca
gcccggaccgtgggctggagcccgctgatgctggccgcactcactgggcggcttggagtg
gcccagcagctggtggagaagggcgccaaccctgaccacctcagcgtgctggagaagacc
gccttcgaggttgcactggactgcaagcacagggaccttgtagactacctggacccgctg
accaccgtcaggcccaaaacagatgaggagaaaaggcgacctgatattttccatgcattg
aaaatgggaaacttccagctggtcaaagagattgccgatgaagaccccagccacgtgaac
ttggtcaatggggacggggcgacgccactgatgctagcagctgttacggggcagctggct
ctggtgcagctgctggtggagaggcacgcggatgttgacaagcaggacagcgtgcatggc
tggacggccctcatgcaggcaacctaccatgggaataaggaaattgtgaaatatctgcta
aaccaaggggccgatgtcactcttcgtgcaaaaaatggatacacggcctttgacctggtg
atgctgctgaatgatcccgacacggaacttgttcgactgctggcatctgtctgcatgcag
gtgaataaagacaaaggccggccgagccaccagcctcccctgccccactcgaaggtccga
cagccctggagcatcccagtgctgcccgatgacaagggtggactgaagtcctggtggaac
cgaatgtccaatcggttccgaaagctcaaactgatgcagacgctgccccgtgggctgtcc
agcaaccagcctttgcctttctctgacgagcctgagccagctctggactccacaatgagg
gctgccccccaggacaagacaagccgctctgcactccctgatgcggcccctgtgaccaaa
gacaatggtcctgggagcacaagaggagaaaaggaagacacgttattgacaaccatgctt
cgaaacggagctcccctcaccagactcccgagtgacaagctgaaagcagtcatcccccca
ttcctacccccttccagttttgagctgtggagctctgatcggtcccggacgcgtcacaac
gggaaggcagaccccatgaagactgcgctgccccagagagccagcaggggccaccccgtg
ggcggcgggggcacagacactacacccgtcaggcctgttaaatttccaagcctccccaga
agcccagcctcttctgccaattctggaaacttcaaccactcgcctcattcatcgggcggc
tccagtggggtaggtgtgagccggcacggtggggagctgcttaaccgctcaggtggcagc
atagacaatgtcttgtcccaaatcgctgcccagaggaaaaaagcagccggattattggag
cagaaacccagccatcggtcaagccctgtggggccagcaccggggtccagcccgtctgag
cttccagcctcccctgcaggtggcagcgctcctgttggcaagaaattggagaccagcaaa
aggcctccatctggaacttccactacctccaagagcacctctccaaccctcacgccctcc
ccctcacccaaagggcacactgcagagtcctcagtgtcttcctcgtcatcccatcggcag
tccaagagcagtgggggctccagcagtggcaccatcacagatgaggatgaactgactgga
atccttaagaaattatcacttgagaaatatcagcccatttttgaggaacaagaggtggac
atggaagcgttcctcacactgactgacggtgacttgaaggagctgggaattaagacagat
gggtccaggcagcagattctggcagcgatttctgaactgaacgcaggcaagggacgcgag
agacaaattttacaggaaaccattcacaactttcactcttcctttgagagcagtgccagc
aacaccagggcccctggcaacagcccctgtgcgtga

DBGET integrated database retrieval system