KEGG   Homo sapiens (human): 203413
Entry
203413            CDS       T01001                                 
Symbol
CT83, CXorf61, KK-LC-1, KKLC1
Name
(RefSeq) cancer/testis antigen 83
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: KKLCAg1 TMCCDC2 Hemolysin_N TrbL_2
Other DBs
NCBI-GeneID: 203413
NCBI-ProteinID: NP_001017978
OMIM: 300625
HGNC: 33494
Ensembl: ENSG00000204019
Pharos: Q5H943(Tdark)
UniProt: Q5H943
Position
X:complement(116461686..116462976)
AA seq 113 aa
MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVY
DLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
NT seq 342 nt   +upstreamnt  +downstreamnt
atgaacttctatttactcctagcgagcagcattctgtgtgccttgattgtcttctggaaa
tatcgccgctttcagagaaacactggcgaaatgtcatcaaattcaactgctcttgcacta
gtgagaccctcttcttctgggttaattaacagcaatacagacaacaatcttgcagtctac
gacctctctcgggatattttaaataatttcccacactcaatagccaggcagaagcgaata
ttggtaaacctcagtatggtggaaaacaagctggttgaactggaacatactctacttagc
aagggtttcagaggtgcatcacctcaccggaaatccacctaa

DBGET integrated database retrieval system