KEGG   Homo sapiens (human): 2035
Entry
2035              CDS       T01001                                 

Gene name
EPB41, 4.1R, EL1, HE
Definition
(RefSeq) erythrocyte membrane protein band 4.1
  KO
K06107  erythrocyte membrane protein band 4.1
Organism
hsa  Homo sapiens (human)
Disease
H00231  Hereditary elliptocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    2035 (EPB41)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     2035 (EPB41)
SSDB
Motif
Pfam: 4_1_CTD FERM_C SAB FERM_N FA FERM_M YAcAr
Other DBs
NCBI-GeneID: 2035
NCBI-ProteinID: NP_001159477
OMIM: 130500
HGNC: 3377
Ensembl: ENSG00000159023
Vega: OTTHUMG00000003644
Pharos: P11171(Tbio)
UniProt: P11171 Q1WWM3 Q59F12
Structure
PDB: 
3QIJ 1GG3 2RQ1

Position
1p35.3
AA seq 864 aa
MTTEKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDT
PTHEDLTKNKERTSESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGT
SLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECS
KIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRVC
EHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDI
TRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQT
KELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGL
LVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVC
VEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRAS
RSLDGAAAVDSADRSPRPTSAPAITQGQVAEGGVLDASAKKTVVPKAQKETVKAEVKKED
EPPEQAEPEPTEAWKVEKTHIEVTVPTSNGDQTQKLAEKTEDLIRMRKKKRERLDGENIY
IRHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNIN
GQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAAQTDDNSGDLD
PGVLLTAQTITSETPSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKE
AKEQHPDMSVTKVVVHQETEIADE
NT seq 2595 nt   +upstreamnt  +downstreamnt
atgacaacagagaagagtttagtgactgaggccgaaaattcacagcaccaacagaaggaa
gagggtgaggaagccataaactcaggccaacaagaacctcagcaggaggaatcttgtcaa
acagcagctgaaggagataattggtgtgaacagaagctgaaagcttctaatggagacact
cctacacatgaagacttgaccaagaacaaggagcggacatcagaaagcagaggactttca
cgactattctcctcgtttctcaaaaggcccaaatctcaggtgtccgaggaagaaggcaaa
gaagtagagtcagataaagaaaaaggtgaaggaggtcagaaagagatagaatttggaacc
agtcttgatgaagagatcattttaaaggccccaattgcagctcctgaaccggaactcaaa
acagacccatctttggatcttcattcattaagcagtgcagaaacacagcctgctcaggaa
gaactcagagaagatccagattttgaaattaaggaaggagaaggacttgaagagtgctcc
aaaatagaagtaaaagaagaaagccctcaatcaaaagcagaaacagaattaaaagcttcc
caaaaaccaatcagaaaacacaggaacatgcactgcaaggtttctttgttggatgacaca
gtttatgaatgtgttgtggagaaacatgctaagggacaagatttgcttaaacgagtatgt
gagcatctcaatcttttggaagaagactattttggtctagccatttgggataacgcaacc
tctaagacatggctggattccgccaaagaaataaaaaagcaggttcgtggtgtcccttgg
aattttacatttaatgtaaagttttatccacctgacccagcacagttaacagaagacata
acaagatattatttatgtcttcagcttcggcaggacatagttgcaggacgtctgccctgt
tcctttgcaaccttagcattattaggttcttacaccatccagtctgaactgggagactac
gacccagaactccatggcgtggattatgttagtgattttaaactggccccgaatcagacc
aaggaacttgaagagaaggtcatggaactgcataagtcatacaggtccatgactccagct
caggctgacttggagtttcttgagaatgccaaaaagttgtctatgtatggagttgatctt
cataaagcaaaggacttggaaggagtagatatcatcctaggtgtctgctctagtggcctt
ctggtttacaaagataagctgagaattaaccgcttcccttggcccaaagtgctgaagatt
tcttataaacgtagtagctttttcatcaagattcggcctggagagcaagagcagtatgaa
agtaccatcggattcaaacttcccagttaccgagcagctaagaaattatggaaagtctgt
gtagaacatcacacgtttttcagattgacatctacagacaccattcccaaaagcaaattt
cttgcgctaggatccaaatttcgatacagtggccggactcaagctcagaccaggcaagct
agtgctctaattgacaggcctgccccacacttcgagcgtacagcaagtaaacgggcgtcc
cggagcctcgatggagcagcagctgtcgattcggcagaccgaagtcctcggcccacttct
gcacctgccattactcagggtcaggttgcagaaggtggcgtcctagatgcctctgctaaa
aaaacagtggtccctaaagcacagaaggaaacagtgaaggctgaagtgaaaaaggaagac
gagccacctgagcaagctgagccagagcccacagaagcatggaaggtggaaaaaacccac
atcgaggtgacagtacccacctcaaatggtgaccaaacacagaagcttgcagaaaaaact
gaagatctgataagaatgaggaagaaaaagagagaaagactagatggtgaaaacatttat
atcagacatagcaatttaatgttggaggatttagacaagagtcaagaggagatcaaaaaa
catcatgccagcatcagtgagctgaaaaagaacttcatggagtctgtaccagaaccacgg
cctagtgaatgggataaacgcttatccactcactcacccttccgaactcttaacatcaat
gggcaaatccccacaggagaaggacctcccctggtgaagacacaaactgtcaccatctca
gataatgccaatgctgtgaaaagtgaaatcccaaccaaagacgtccctattgtccacact
gagaccaagaccatcacttatgaggctgcccagactgacgacaacagtggagacttggac
ccaggagtcttgctgacagctcaaactatcacatctgagaccccaagcagcaccaccaca
actcaaattaccaagactgtaaaaggtgggatttcagagacacgtattgaaaagagaatt
gtgatcacaggagatgctgatattgaccatgatcaggtccttgtacaagccatcaaggag
gcaaaggagcagcacccagacatgtcagtgaccaaggtggtcgtccaccaggagaccgag
attgctgatgagtga

DBGET integrated database retrieval system