KEGG   Homo sapiens (human): 2036Help
Entry
2036              CDS       T01001                                 

Gene name
EPB41L1, 4.1N, MRD11
Definition
(RefSeq) erythrocyte membrane protein band 4.1 like 1
  KO
K06107  erythrocyte membrane protein band 4.1
Organism
hsa  Homo sapiens (human)
Disease
H00773  Autosomal dominant mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    2036 (EPB41L1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     2036 (EPB41L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 4_1_CTD FERM_C SAB FERM_N FERM_M FA
Motif
Other DBs
NCBI-GeneID: 2036
NCBI-ProteinID: NP_036288
OMIM: 602879
HGNC: 3378
Ensembl: ENSG00000088367
Vega: OTTHUMG00000032378
Pharos: Q9H4G0(Tbio)
UniProt: Q9H4G0
Position
20q11.23
AA seq 881 aa AA seqDB search
MTTETGPDSEVKKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQS
LDMEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQ
VLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDP
AQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSEL
RFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIML
GVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSA
KRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERS
SSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKRDEDGESGGQRSEAEEGEVRTPTKIK
ELKPEQETTPRHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPS
SPASPSPKGTPEKANERAGLREGSEEKVKPPRPRAPESDTGDEDQDQERDTVFLKDNHLA
IERKCSSITVSSTSSLEAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRD
LNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTR
VSAMDNTQQVDGSASVGREFIATTPSITTETISTTMENSLKSGKGAAAMIPGPQTVATEI
RSLSPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQ
ALALAIKEAKLQHPDMLVTKAVVYRETDPSPEERDKKPQES
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagagacaggccccgactctgaggtgaagaaagctcaggaggaggccccgcag
cagcccgaggctgctgccgctgtgaccacccctgtgacccctgcaggccacggccaccca
gaggccaactccaatgagaagcatccatcccagcaggacacgcggcctgctgaacagagc
ctagacatggaggagaaggactacagtgaggccgatggcctttcggagaggaccacgccc
agcaaggcccagaaatcgccccagaagattgccaagaaatacaagagtgccatctgccgg
gtcactctgcttgatgcctcggagtatgagtgtgaggtggagaaacatggccggggccag
gtgctgtttgacctggtctgtgaacacctcaacctcctagagaaggactacttcggcctg
accttctgtgatgctgacagccagaagaactggctggacccctccaaggagatcaagaag
cagatccggagtagcccctggaattttgccttcacagtcaagttctacccgcctgatcct
gcccagctgacagaagacatcacaagatactacctgtgcctgcagctgcgggcagacatc
atcacgggccggctgccatgctcctttgtcacgcatgccctactgggctcctacgctgtg
caggctgagctgggtgactatgatgctgaggagcatgtgggcaactatgtcagcgagctc
cgcttcgcccctaaccagacccgggagctggaggagaggatcatggagctgcataagaca
tatagggggatgaccccgggagaagcagaaatccacttcttagagaatgccaagaagctt
tccatgtacggagtagacctgcaccatgccaaggactctgagggcatcgacatcatgtta
ggcgtttgtgccaatggcctgctcatctaccgggaccggctgagaatcaaccgctttgcc
tggcccaagatcctcaagatctcctacaagaggagtaacttctatatcaagatccggcct
ggggagtatgagcaatttgagagcacaattggctttaagctcccaaaccaccggtcagcc
aagagactgtggaaggtctgcatcgagcatcatacattcttccggctggtgtcccctgag
cccccacccaagggcttcctggtgatgggctccaagttccggtacagtgggaggacccag
gcacagactcgccaggccagcgccctcattgaccggcctgcacccttctttgagcgttct
tccagcaaacggtacaccatgtcccgcagccttgatggagcagagttctcccgcccagcc
tcggtcagcgagaaccatgatgcagggcctgacggtgacaagcgggatgaggatggcgag
tctggggggcaacggtcagaggctgaggagggagaggtcaggactccaaccaagatcaag
gagctaaagccggagcaggaaaccacgccgagacacaagcaggagttcttagacaagcca
gaagatgtcttgctgaagcaccaggccagcatcaatgagctcaaaaggaccctgaaggag
cccaacagcaaactcatccaccgggatcgagactgggaacgggagcgcaggctgccctcc
tcccccgcctccccctcccccaagggcacccctgagaaagccaatgagagagcagggctg
agggagggctccgaggagaaagtcaaaccaccacgtccccgggccccagagagtgacaca
ggcgatgaggaccaggaccaggagagggacacggtgttcctgaaggacaaccacctggcc
attgagcgcaagtgctccagcatcacggtcagctctacgtctagcctggaggctgaggtg
gacttcacggtcattggtgactaccatggcagcgccttcgaagacttctcccgcagcctg
cctgagctcgaccgggacaaaagcgactcggacactgagggcctgctgttctcccgggat
ctcaacaagggggcccccagccaggatgatgagtctgggggcattgaggacagcccggat
cgaggggcctgctccaccccggatatgccccagtttgagcccgtgaaaacagaaaccatg
actgtcagcagtctggccattagaaagaagattgagccggaggccgtactgcagaccaga
gtctccgctatggataacacccagcaggttgatgggagtgcctcagtggggagggagttc
atagcaaccactccctccatcaccacggagaccatatcgaccaccatggagaacagtctc
aagtccgggaagggggcagctgccatgatcccaggcccacagacggtggccacggaaatc
cgttctctttctccgatcatcgggaaagatgtcctcaccagcacctacggcgccactgcg
gaaaccctctcaacctccaccaccacccatgtcaccaaaactgtgaaaggagggttttct
gagacaaggatcgagaagcgaatcatcattactggggatgaagatgtcgatcaagaccag
gccctggctttggccatcaaggaggccaaactgcagcatcctgatatgctggtaaccaaa
gctgtcgtatacagagaaacagacccatccccagaggagagggacaagaagccacaggaa
tcctga

DBGET integrated database retrieval system