KEGG   Homo sapiens (human): 2048Help
Entry
2048              CDS       T01001                                 

Gene name
EPHB2, CAPB, DRT, EK5, EPHT3, ERK, Hek5, PCBC, Tyro5
Definition
(RefSeq) EPH receptor B2
  KO
K05111  Eph receptor B2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Drug target
Sitravatinib: D11140
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    2048 (EPHB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2048 (EPHB2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2048 (EPHB2)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2048 (EPHB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N SusE cEGF Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 2048
NCBI-ProteinID: NP_001296122
OMIM: 600997
HGNC: 3393
Ensembl: ENSG00000133216
Vega: OTTHUMG00000002881
Pharos: P29323(Tchem)
UniProt: P29323 Q6NVW1 Q4LE53
Structure
PDB: 

Position
1p36.12
AA seq 1055 aa AA seqDB search
MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQ
VCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADF
DSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQD
YGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLY
CNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGA
TNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNI
ICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPF
SPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSE
YNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEK
LPLIIGSSAAGLVFLIAVVVIAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPF
TYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYT
EKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTV
IQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTY
TSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIE
QDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGI
NLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTL
AGHQKKILNSIQVMRAQMNQIQSVEGQPLARRPRATGRTKRCQPRDVTKKTCNSNDGKKK
GMGKKKTDPGRGREIQGIFFKEDSHKESNDCSCGG
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcggaggctgggggccgcgctgctgctgctgccgctgctcgccgccgtggaa
gaaacgctaatggactccactacagcgactgctgagctgggctggatggtgcatcctcca
tcagggtgggaagaggtgagtggctacgatgagaacatgaacacgatccgcacgtaccag
gtgtgcaacgtgtttgagtcaagccagaacaactggctacggaccaagtttatccggcgc
cgtggcgcccaccgcatccacgtggagatgaagttttcggtgcgtgactgcagcagcatc
cccagcgtgcctggctcctgcaaggagaccttcaacctctattactatgaggctgacttt
gactcggccaccaagaccttccccaactggatggagaatccatgggtgaaggtggatacc
attgcagccgacgagagcttctcccaggtggacctgggtggccgcgtcatgaaaatcaac
accgaggtgcggagcttcggacctgtgtcccgcagcggcttctacctggccttccaggac
tatggcggctgcatgtccctcatcgccgtgcgtgtcttctaccgcaagtgcccccgcatc
atccagaatggcgccatcttccaggaaaccctgtcgggggctgagagcacatcgctggtg
gctgcccggggcagctgcatcgccaatgcggaagaggtggatgtacccatcaagctctac
tgtaacggggacggcgagtggctggtgcccatcgggcgctgcatgtgcaaagcaggcttc
gaggccgttgagaatggcaccgtctgccgaggttgtccatctgggactttcaaggccaac
caaggggatgaggcctgtacccactgtcccatcaacagccggaccacttctgaaggggcc
accaactgtgtctgccgcaatggctactacagagcagacctggaccccctggacatgccc
tgcacaaccatcccctccgcgccccaggctgtgatttccagtgtcaatgagacctccctc
atgctggagtggacccctccccgcgactccggaggccgagaggacctcgtctacaacatc
atctgcaagagctgtggctcgggccggggtgcctgcacccgctgcggggacaatgtacag
tacgcaccacgccagctaggcctgaccgagccacgcatttacatcagtgacctgctggcc
cacacccagtacaccttcgagatccaggctgtgaacggcgttactgaccagagccccttc
tcgcctcagttcgcctctgtgaacatcaccaccaaccaggcagctccatcggcagtgtcc
atcatgcatcaggtgagccgcaccgtggacagcattaccctgtcgtggtcccagccggac
cagcccaatggcgtgatcctggactatgagctgcagtactatgagaaggagctcagtgag
tacaacgccacagccataaaaagccccaccaacacggtcaccgtgcagggcctcaaagcc
ggcgccatctatgtcttccaggtgcgggcacgcaccgtggcaggctacgggcgctacagc
ggcaagatgtacttccagaccatgacagaagccgagtaccagacaagcatccaggagaag
ttgccactcatcatcggctcctcggccgctggcctggtcttcctcattgctgtggttgtc
atcgccatcgtgtgtaacagacgggggtttgagcgtgctgactcggagtacacggacaag
ctgcaacactacaccagtggccacatgaccccaggcatgaagatctacatcgatcctttc
acctacgaggaccccaacgaggcagtgcgggagtttgccaaggaaattgacatctcctgt
gtcaaaattgagcaggtgatcggagcaggggagtttggcgaggtctgcagtggccacctg
aagctgccaggcaagagagagatctttgtggccatcaagacgctcaagtcgggctacacg
gagaagcagcgccgggacttcctgagcgaagcctccatcatgggccagttcgaccatccc
aacgtcatccacctggagggtgtcgtgaccaagagcacacctgtgatgatcatcaccgag
ttcatggagaatggctccctggactcctttctccggcaaaacgatgggcagttcacagtc
atccagctggtgggcatgcttcggggcatcgcagctggcatgaagtacctggcagacatg
aactatgttcaccgtgacctggctgcccgcaacatcctcgtcaacagcaacctggtctgc
aaggtgtcggactttgggctctcacgctttctagaggacgatacctcagaccccacctac
accagtgccctgggcggaaagatccccatccgctggacagccccggaagccatccagtac
cggaagttcacctcggccagtgatgtgtggagctacggcattgtcatgtgggaggtgatg
tcctatggggagcggccctactgggacatgaccaaccaggatgtaatcaatgccattgag
caggactatcggctgccaccgcccatggactgcccgagcgccctgcaccaactcatgctg
gactgttggcagaaggaccgcaaccaccggcccaagttcggccaaattgtcaacacgcta
gacaagatgatccgcaatcccaacagcctcaaagccatggcgcccctctcctctggcatc
aacctgccgctgctggaccgcacgatccccgactacaccagctttaacacggtggacgag
tggctggaggccatcaagatggggcagtacaaggagagcttcgccaatgccggcttcacc
tcctttgacgtcgtgtctcagatgatgatggaggacattctccgggttggggtcactttg
gctggccaccagaaaaaaatcctgaacagtatccaggtgatgcgggcgcagatgaaccag
attcagtctgtggagggccagccactcgccaggaggccacgggccacgggaagaaccaag
cggtgccagccacgagacgtcaccaagaaaacatgcaactcaaacgacggaaaaaaaaag
ggaatgggaaaaaagaaaacagatcctgggagggggcgggaaatacaaggaatatttttt
aaagaggattctcataaggaaagcaatgactgttcttgcgggggataa

DBGET integrated database retrieval system