KEGG   Homo sapiens (human): 2049Help
Entry
2049              CDS       T01001                                 

Gene name
EPHB3, EK2, ETK2, HEK2, TYRO6
Definition
(RefSeq) EPH receptor B3
  KO
K05112  Eph receptor B3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2049 (EPHB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2049 (EPHB3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2049 (EPHB3)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2049 (EPHB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Ephrin_rec_like Pur_ac_phosph_N Interfer-bind Cadherin_C_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 2049
NCBI-ProteinID: NP_004434
OMIM: 601839
HGNC: 3394
Ensembl: ENSG00000182580
Vega: OTTHUMG00000156710
Pharos: P54753(Tchem)
UniProt: P54753
Structure
PDB: 

Position
3q27.1
AA seq 998 aa AA seqDB search
MARARPPPPPSPPPGLLPLLPPLLLLPLLLLPAGCRALEETLMDTKWVTSELAWTSHPES
GWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIP
NIPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRS
FGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGT
CIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGP
CLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWS
EPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTR
YTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPN
GVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEF
ETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQY
IAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREV
FVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALD
SFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLS
RFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYW
DMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAA
SLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQM
TAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atggccagagcccgcccgccgccgccgccgtcgccgccgccggggcttctgccgctgctc
cctccgctgctgctgctgccgctgctgctgctgcccgccggctgccgggcgctggaagag
accctcatggacacaaaatgggtaacatctgagttggcgtggacatctcatccagaaagt
gggtgggaagaggtgagtggctacgatgaggccatgaatcccatccgcacataccaggtg
tgtaatgtgcgcgagtcaagccagaacaactggcttcgcacggggttcatctggcggcgg
gatgtgcagcgggtctacgtggagctcaagttcactgtgcgtgactgcaacagcatcccc
aacatccccggctcctgcaaggagaccttcaacctcttctactacgaggctgacagcgat
gtggcctcagcctcctcccccttctggatggagaacccctacgtgaaagtggacaccatt
gcacccgatgagagcttctcgcggctggatgccggccgtgtcaacaccaaggtgcgcagc
tttgggccactttccaaggctggcttctacctggccttccaggaccagggcgcctgcatg
tcgctcatctccgtgcgcgccttctacaagaagtgtgcatccaccaccgcaggcttcgca
ctcttccccgagaccctcactggggcggagcccacctcgctggtcattgctcctggcacc
tgcatccctaacgccgtggaggtgtcggtgccactcaagctctactgcaacggcgatggg
gagtggatggtgcctgtgggtgcctgcacctgtgccaccggccatgagccagctgccaag
gagtcccagtgccgcccctgtccccctgggagctacaaggcgaagcagggagaggggccc
tgcctcccatgtccccccaacagccgtaccacctccccagccgccagcatctgcacctgc
cacaataacttctaccgtgcagactcggactctgcggacagtgcctgtaccaccgtgcca
tctccaccccgaggtgtgatctccaatgtgaatgaaacctcactgatcctcgagtggagt
gagccccgggacctgggtggccgggatgacctcctgtacaatgtcatctgcaagaagtgc
catggggctggaggggcctcagcctgctcacgctgtgatgacaacgtggagtttgtgcct
cggcagctgggcctgacggagcgccgggtccacatcagccatctgctggcccacacgcgc
tacacctttgaggtgcaggcggtcaacggtgtctcgggcaagagccctctgccgcctcgt
tatgcggccgtgaatatcaccacaaaccaggctgccccgtctgaagtgcccacactacgc
ctgcacagcagctcaggcagcagcctcaccctatcctgggcacccccagagcggcccaac
ggagtcatcctggactacgagatgaagtactttgagaagagcgagggcatcgcctccaca
gtgaccagccagatgaactccgtgcagctggacgggcttcggcctgacgcccgctatgtg
gtccaggtccgtgcccgcacagtagctggctatgggcagtacagccgccctgccgagttt
gagaccacaagtgagagaggctctggggcccagcagctccaggagcagcttcccctcatc
gtgggctccgctacagctgggcttgtcttcgtggtggctgtcgtggtcatcgctatcgtc
tgcctcaggaagcagcgacacggctctgattcggagtacacggagaagctgcagcagtac
attgctcctggaatgaaggtttatattgacccttttacctacgaggaccctaatgaggct
gttcgggagtttgccaaggagatcgacgtgtcctgcgtcaagatcgaggaggtgatcgga
gctggggaatttggggaagtgtgccgtggtcgactgaaacagcctggccgccgagaggtg
tttgtggccatcaagacgctgaaggtgggctacaccgagaggcagcggcgggacttccta
agcgaggcctccatcatgggtcagtttgatcaccccaatataatccggctcgagggcgtg
gtcaccaaaagtcggccagttatgatcctcactgagttcatggaaaactgcgccctggac
tccttcctccggctcaacgatgggcagttcacggtcatccagctggtgggcatgttgcgg
ggcattgctgccggcatgaagtacctgtccgagatgaactatgtgcaccgcgacctggct
gctcgcaacatccttgtcaacagcaacctggtctgcaaagtctcagactttggcctctcc
cgcttcctggaggatgacccctccgatcctacctacaccagttccctgggcgggaagatc
cccatccgctggactgccccagaggccatagcctatcggaagttcacttctgctagtgat
gtctggagctacggaattgtcatgtgggaggtcatgagctatggagagcgaccctactgg
gacatgagcaaccaggatgtcatcaatgccgtggagcaggattaccggctgccaccaccc
atggactgtcccacagcactgcaccagctcatgctggactgctgggtgcgggaccggaac
ctcaggcccaaattctcccagattgtcaataccctggacaagctcatccgcaatgctgcc
agcctcaaggtcattgccagcgctcagtctggcatgtcacagcccctcctggaccgcacg
gtcccagattacacaaccttcacgacagttggtgattggctggatgccatcaagatgggg
cggtacaaggagagcttcgtcagtgcggggtttgcatcttttgacctggtggcccagatg
acggcagaagacctgctccgtattggggtcaccctggccggccaccagaagaagatcctg
agcagtatccaggacatgcggctgcagatgaaccagacgctgcctgtgcaggtctga

DBGET integrated database retrieval system