KEGG   Homo sapiens (human): 205
Entry
205               CDS       T01001                                 

Gene name
AK4, AK_4, AK3, AK3L1, AK3L2
Definition
(RefSeq) adenylate kinase 4
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00730  Thiamine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    205 (AK4)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    205 (AK4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    205 (AK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     205 (AK4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   205 (AK4)
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_18 Cytidylate_kin AAA_33 Thymidylate_kin AAA AAA_28 SKI NACHT NTPase_1 AAA_22 AAA_16 AAA_5 ABC_tran RuvB_N ATP_bind_1
Other DBs
NCBI-GeneID: 205
NCBI-ProteinID: NP_001005353
OMIM: 103030
HGNC: 363
Ensembl: ENSG00000162433
Vega: OTTHUMG00000009033
Pharos: P27144(Tbio)
UniProt: P27144
Structure
PDB: 
2BBW 2AR7 3NDP

Position
1p31.3
AA seq 223 aa
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEK
SLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLK
DRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKP
VIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcttccaaactcctgcgcgcggtcatcctcgggccgcccggctcgggcaagggcacc
gtgtgccagaggatcgcccagaactttggtctccagcatctctccagcggccacttcttg
cgggagaacatcaaggccagcaccgaagttggtgagatggcaaagcagtatatagagaaa
agtcttttggttccagaccatgtgatcacacgcctaatgatgtccgagttggagaacagg
cgtggccagcactggctccttgatggttttcctaggacattaggacaagccgaagccctg
gacaaaatctgtgaagtggatctagtgatcagtttgaatattccatttgaaacacttaaa
gatcgtctcagccgccgttggattcaccctcctagcggaagggtatataacctggacttc
aatccacctcatgtacatggtattgatgacgtcactggtgaaccgttagtccagcaggag
gatgataaacccgaagcagttgctgccaggctaagacagtacaaagacgtggcaaagcca
gtcattgaattatacaagagccgaggagtgctccaccaattttccggaacggagacgaac
aaaatctggccctacgtttacacacttttctcaaacaagatcacacctattcagtccaaa
gaagcatattga

DBGET integrated database retrieval system