KEGG   Homo sapiens (human): 2052Help
Entry
2052              CDS       T01001                                 

Gene name
EPHX1, EPHX, EPOX, HYL1, MEH
Definition
(RefSeq) epoxide hydrolase 1
  KO
K01253  microsomal epoxide hydrolase [EC:3.3.2.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa04976  Bile secretion
hsa05204  Chemical carcinogenesis
Disease
H01935  Familial hypercholanemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2052 (EPHX1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    2052 (EPHX1)
 09160 Human Diseases
  09161 Cancers: Overview
   05204 Chemical carcinogenesis
    2052 (EPHX1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    2052 (EPHX1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.9  microsomal epoxide hydrolase
     2052 (EPHX1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S33
   2052 (EPHX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EHN Abhydrolase_1 Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 2052
NCBI-ProteinID: NP_000111
OMIM: 132810
HGNC: 3401
Ensembl: ENSG00000143819
Vega: OTTHUMG00000037743
Pharos: P07099(Tchem)
UniProt: P07099 R4SBI6
Position
1q42.12
AA seq 455 aa AA seqDB search
MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEI
HDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKI
EGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEV
ICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVP
SHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVELLYPVKEKVFYSLMRESGYM
HIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFSLDDLLTNVML
YWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKL
ISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtggctagaaatcctcctcacttcagtgctgggctttgccatctactggttcatctcc
cgggacaaagaggaaactttgccacttgaagatgggtggtgggggccaggcacgaggtcc
gcagccagggaggacgacagcatccgccctttcaaggtggaaacgtcagatgaggagatc
cacgacttacaccagaggatcgataagttccgtttcaccccacctttggaggacagctgc
ttccactatggcttcaactccaactacctgaagaaagtcatctcctactggcggaatgaa
tttgactggaagaagcaggtggagattctcaacagataccctcacttcaagactaagatt
gaagggctggacatccacttcatccacgtgaagcccccccagctgcccgcaggccatacc
ccgaagcccttgctgatggtgcacggctggcccggctctttctacgagttttataagatc
atcccactcctgactgaccccaagaaccatggcctgagcgatgagcacgtttttgaagtc
atctgcccttccatccctggctatggcttctcagaggcatcctccaagaaggggttcaac
tcggtggccaccgccaggatcttttacaagctgatgctgcggctgggcttccaggaattc
tacattcaaggaggggactgggggtccctgatctgcactaatatggcccagctggtgccc
agccacgtgaaaggcctgcacttgaacatggctttggttttaagcaacttctctaccctg
accctcctcctgggacagcgtttcgggaggtttcttggcctcactgagagggatgtggag
ctgctgtaccccgtcaaggagaaggtattctacagcctgatgagggagagcggctacatg
cacatccagtgcaccaagcctgacaccgtaggctctgctctgaatgactctcctgtgggt
ctggctgcctatattctagagaagttttccacctggaccaatacggaattccgatacctg
gaggatggaggcctggaaaggaagttctccctggacgacctgctgaccaacgtcatgctc
tactggacaacaggcaccatcatctcctcccagcgcttctacaaggagaacctgggacag
ggctggatgacccagaagcatgagcggatgaaggtctatgtgcccactggcttctctgcc
ttcccttttgagctattgcacacgcctgaaaagtgggtgaggttcaagtacccaaagctc
atctcctattcctacatggttcgtgggggccactttgcggcctttgaggagccggagctg
ctcgcccaggacatccgcaagttcctgtcggtgctggagcggcaatga

DBGET integrated database retrieval system