KEGG   Homo sapiens (human): 205327
Entry
205327            CDS       T01001                                 
Symbol
C2orf69, COXPD53
Name
(RefSeq) chromosome 2 open reading frame 69
Organism
hsa  Homo sapiens (human)
Disease
H00891  Combined oxidative phosphorylation deficiency
SSDB
Motif
Pfam: C2orf69
Other DBs
NCBI-GeneID: 205327
NCBI-ProteinID: NP_710156
OMIM: 619219
HGNC: 26799
Ensembl: ENSG00000178074
Pharos: Q8N8R5(Tdark)
UniProt: Q8N8R5
Position
2:199911293..199928273
AA seq 385 aa
MWGFRLLRSPPLLLLLPQLGIGNASSCSQARTMNPGGSGGARCSLSAEVRRRQCLQLSTV
PGADPQRSNELLLLAAAGEGLERQDLPGDPAKEEPQPPPQHHVLYFPGDVQNYHEIMTRH
PENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEHNTD
FGAFKHLYMLLVNAFNLSQNSLSKKSLNVWNKDSIASNCRSSPSHTTNGCQGEKVRTCEK
SDESAMSFYPPSLNDASFTLIGFSKGCVVLNQLLFELKEAKKDKNIDAFIKSIRTMYWLD
GGHSGGSNTWVTYPEVLKEFAQTGIIVHTHVTPYQVRDPMRSWIGKEHKKFVQILGDLGM
QVTSQIHFTKEAPSIENHFRVHEVF
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgtgggggttcaggctcctgcggtcgccgccgttgctgctcctgctgccgcagctcgga
atcggaaacgcctcgtcctgctctcaggccagaaccatgaacccgggcggcagcggcggc
gcgcgatgctccctctcggccgaggtgcgccgccgtcagtgcctgcagctttccaccgtg
cctggagccgatccgcagcgcagcaacgaattgctcctgttggcggcggccggggaggga
ctggagcggcaggacctccccggggacccagcgaaggaggagccgcagccgccgccccag
catcacgtcctctatttccctggggatgtgcagaattaccatgaaattatgactcgtcat
cctgagaattatcaatgggaaaactggagtctagaaaatgttgctaccattttagcccac
cggttccccaatagttatatttgggtgataaaatgttcccgaatgcatttgcacaaattc
agctgctatgacaattttgtgaaaagtaacatgtttggtgccccagaacacaatactgac
tttggagcttttaagcacctttatatgttattagttaatgcttttaatttaagtcagaat
agtttatcaaagaaaagtttgaatgtttggaataaggactccatagcatctaactgtaga
tccagtccttctcatactacgaatggttgccagggagaaaaagtgaggacctgtgaaaaa
tctgatgagtctgccatgagtttttatccaccatcactaaatgacgcatcttttactttg
attggattcagtaaaggttgtgttgttttgaatcagttgctttttgaattgaaagaagcc
aagaaagacaagaacatagatgcttttatcaaaagcataagaacaatgtattggctggat
ggtggtcattctggaggaagcaatacttgggttacttatccagaagtcttgaaagaattt
gcacaaacaggaattatcgttcacactcatgtaacaccttaccaagtacgtgatccaatg
agatcttggattggaaaggagcacaagaaatttgttcagatacttggggatcttggtatg
caggtgactagccaaattcattttacaaaggaagctccttccatagagaatcacttcagg
gttcatgaagtattttga

DBGET integrated database retrieval system