KEGG   Homo sapiens (human): 206338Help
Entry
206338            CDS       T01001                                 

Gene name
LVRN, APQ, AQPEP, TAQPEP
Definition
(RefSeq) laeverin
  KO
K13724  aminopeptidase Q [EC:3.4.11.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    206338 (LVRN)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     206338 (LVRN)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M1
   206338 (LVRN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Motif
Other DBs
NCBI-GeneID: 206338
NCBI-ProteinID: NP_776161
OMIM: 610046
HGNC: 26904
Ensembl: ENSG00000172901
Vega: OTTHUMG00000128890
Pharos: Q6Q4G3(Tbio)
UniProt: Q6Q4G3 Q0P5U8
Position
5q23.1
AA seq 990 aa AA seqDB search
MGPPSSSGFYVSRAVALLLAGLVAALLLALAVLAALYGHCERVPPSELPGLRDLEAESSP
PLRQKPTPTPKPSSARELAVTTTPSNWRPPGPWDQLRLPPWLVPLHYDLELWPQLRPDEL
PAGSLPFTGRVNITVRCTVATSRLLLHSLFQDCERAEVRGPLSPGTGNATVGRVPVDDVW
FALDTEYMVLELSEPLKPGSSYELQLSFSGLVKEDLREGLFLNVYTDQGERRALLASQLE
PTFARYVFPCFDEPALKATFNITMIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFSTT
PHMPTYLVAFVICDYDHVNRTERGKEIRIWARKDAIANGSADFALNITGPIFSFLEDLFN
ISYSLPKTDIIALPSFDNHAMENWGLMIFDESGLLLEPKDQLTEKKTLISYVVSHEIGHQ
WFGNLVTMNWWNNIWLNEGFASYFEFEVINYFNPKLPRNEIFFSNILHNILREDHALVTR
AVAMKVENFKTSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQ
DDLWRHFQMAIDDQSTVILPATIKNIMDSWTHQSGFPVITLNVSTGVMKQEPFYLENIKN
RTLLTSNDTWIVPILWIKNGTTQPLVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRV
NYDKLGWKKLNQQLEKDPKAIPVIHRLQLIDDAFSLSKNNYIEIETALELTKYLAEEDEI
IVWHTVLVNLVTRDLVSEVNIYDIYSLLKRYLLKRLNLIWNIYSTIIRENVLALQDDYLA
LISLEKLFVTACWLGLEDCLQLSKELFAKWVDHPENEIPYPIKDVVLCYGIALGSDKEWD
ILLNTYTNTTNKEEKIQLAYAMSCSKDPWILNRYMEYAISTSPFTSNETNIIEVVASSEV
GRYVAKDFLVNNWQAVSKRYGTQSLINLIYTIGRTVTTDLQIVELQQFFSNMLEEHQRIR
VHANLQTIKNENLKNKKLSARIAAWLRRNT
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atggggcccccttccagctcaggcttctatgtgagccgcgcagtggccctgctgctggct
gggctggtagccgccctcctgctggcgctggccgtactcgccgccttgtacggccactgc
gagcgcgtcccaccgtcggagctgcctggactcagggacttggaagccgagtcttcccct
cccctcaggcagaagccgacgccaaccccgaaacccagcagtgcacgcgagctagcggtg
acgaccaccccgagcaactggcgacccccggggccctgggaccagctacgcctgccgccc
tggctcgtgccgctgcactacgatctggagctgtggccgcagctgaggcccgacgagctt
ccggccgggtctttgcccttcactggccgcgtgaacatcacggtgcgctgcacggtggcc
acctctcgactgctgctgcatagcctcttccaggactgcgagcgcgccgaggtgcgggga
cccctttccccgggcactgggaacgccacagtgggccgcgtgcccgtggacgacgtgtgg
ttcgcgctggacacggaatacatggtgctggagctcagtgagcccctgaaacctggtagc
agctacgagctgcagcttagcttctcgggcctggtgaaggaagacctcagggagggactc
ttcctcaacgtctacaccgaccagggcgagcgcagggccctgttagcgtcccagctggaa
ccaacatttgccaggtatgttttcccttgttttgatgagccagctctgaaggcaactttt
aatattacaatgattcatcatccaagttatgtggccctttccaacatgccaaagctaggt
cagtctgaaaaagaagatgtgaatggaagcaaatggactgttacaaccttttccactacg
ccccacatgccaacttacttagtcgcatttgttatatgtgactatgaccacgtcaacaga
acagaaaggggcaaggagatacgcatctgggcccggaaagatgcaattgcaaatggaagt
gcagactttgctttgaacatcacaggtcccatcttctcttttctggaggatttgtttaat
atcagttactctcttccaaaaacagatataattgccttgcctagttttgacaaccatgca
atggaaaactggggactaatgatatttgatgaatcaggattgttgttggaaccaaaagat
caactgacagaaaaaaagactctgatctcctatgttgtctcccacgagattggacaccag
tggtttggaaacttggttaccatgaattggtggaacaatatctggctcaacgagggtttt
gcatcttattttgagtttgaagtaattaactactttaatcctaaactcccaagaaatgag
atctttttttctaacattttacataatatcctcagagaagatcacgccctggtgactaga
gctgtggccatgaaggtggaaaatttcaaaacaagtgaaatacaggaactctttgacata
tttacttacagcaagggagcgtctatggcccggatgctttcttgtttcttgaatgagcat
ttatttgtcagtgcactcaagtcatatttgaagacattttcctactcaaacgctgagcaa
gatgatctatggaggcattttcaaatggccatagatgaccagagtacagttattttgcca
gcaacaataaaaaacataatggacagttggacacaccagagtggttttccagtgatcact
ttaaatgtgtctactggcgtcatgaaacaggagccattttatcttgaaaacattaaaaat
cggactcttctaaccagcaatgacacatggattgtccctattctttggataaaaaatgga
actacacaacctttagtctggctagatcaaagcagcaaagtattcccagaaatgcaagtt
tcagattctgaccatgactgggtgattttgaatttgaatatgactggatattatagagtt
aattatgataaattaggttggaagaaactaaatcaacaacttgaaaaggatcctaaggcg
attcctgttattcacagactgcagttgattgatgatgccttttccttgtctaaaaacaat
tatattgagattgaaacagcacttgagttaaccaagtaccttgctgaagaagatgaaatt
atagtatggcatacagtcttggtaaacttggtaaccagggatcttgtttctgaggtgaac
atctatgatatatactcattattaaagaggtacctattaaagagacttaatttaatatgg
aatatttattcaactataattcgtgaaaatgtgttggcattacaagatgactacttagct
ctaatatcactggaaaaactttttgtaactgcgtgttggttgggccttgaagactgcctt
cagctgtcaaaagaacttttcgcaaaatgggtggatcatccagaaaatgaaataccttat
ccaattaaagatgtggttttatgttatggcattgccttgggaagtgataaagagtgggac
atcttgttaaatacttacactaatacaacaaacaaagaagaaaagattcaacttgcttat
gcaatgagctgcagcaaagacccatggatacttaacagatatatggagtatgccatcagc
acatctccattcacttctaatgaaacaaatataattgaggttgtggcttcatctgaagtt
ggccggtatgtcgcaaaagacttcttagtcaacaactggcaagctgtgagtaaaaggtat
ggaacacaatcattgattaatctaatatatacaatagggagaaccgtaactacagattta
cagattgtggagctgcagcagtttttcagtaacatgttggaggaacaccagaggatcaga
gttcatgccaacttacagacaataaagaatgaaaatctgaaaaacaagaagctaagtgcc
aggatagctgcgtggctaaggagaaacacatag

DBGET integrated database retrieval system