KEGG   Homo sapiens (human): 206358
Entry
206358            CDS       T01001                                 

Gene name
SLC36A1, Dct1, LYAAT1, PAT1, TRAMD3
Definition
(RefSeq) solute carrier family 36 member 1
  KO
K14209  solute carrier family 36 (proton-coupled amino acid transporter)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    206358 (SLC36A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    206358 (SLC36A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    206358 (SLC36A1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    206358 (SLC36A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC36: Proton-coupled amino acid transporter
   206358 (SLC36A1)
SSDB
Motif
Pfam: Aa_trans SLD3
Other DBs
NCBI-GeneID: 206358
NCBI-ProteinID: NP_510968
OMIM: 606561
HGNC: 18761
Ensembl: ENSG00000123643
Vega: OTTHUMG00000130125
Pharos: Q7Z2H8(Tbio)
UniProt: Q7Z2H8
Position
5q33.1
AA seq 476 aa
MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGN
IGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTV
MYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNC
HNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIV
QRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPLILYLGMVIVT
ILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVPAEIIIP
FFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLE
VTTFYSEGMSPLTIFKDALISILGFVGFVVGTYEALYELIQPSNAPIFINSTCAFI
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgtccacgcagagacttcggaatgaagactaccacgactacagctccacggacgtgagc
cctgaggagagcccgtcggaaggcctcaacaacctctcctccccgggctcctaccagcgc
tttggtcaaagcaatagcacaacatggttccagaccttgatccacctgttaaaaggcaac
attggcacaggactcctgggactccctctggcggtgaaaaatgcaggcatcgtgatgggt
cccatcagcctgctgatcataggcatcgtggccgtgcactgcatgggtatcctggtgaaa
tgtgctcaccacttctgccgcaggctgaataaatcctttgtggattatggtgatactgtg
atgtatggactagaatccagcccctgctcctggctccggaaccacgcacactggggaaga
cgtgttgtggacttcttcctgattgtcacccagctgggattctgctgtgtctattttgtg
tttctggctgacaactttaaacaggtgatagaagcggccaatgggaccaccaataactgc
cacaacaatgagacggtgattctgacgcctaccatggactcgcgactctacatgctctcc
ttcctgcccttcctggtgctgctggttttcatcaggaacctccgagccctgtccatcttc
tccctgttggccaacatcaccatgctggtcagcttggtcatgatctaccagttcattgtt
cagaggatcccagaccccagccacctccccttggtggccccttggaagacctaccctctc
ttctttggcacagcgattttttcatttgaaggcattggaatggttctgcccctggaaaac
aaaatgaaggatcctcggaagttcccactcatcctgtacctgggcatggtcatcgtcacc
atcctctacatcagcctggggtgtctggggtacctgcaatttggagctaatatccaaggc
agcataaccctcaacctgcccaactgctggttgtaccagtcagttaagctgctgtactcc
atcgggatctttttcacctacgcactccagttctacgtcccggctgagatcatcatcccc
ttctttgtgtcccgagcgcccgagcactgtgagttagtggtggacctgtttgtgcgcaca
gtgctggtctgcctgacatgcatcttggccatcctcatcccccgcctggacctggtcatc
tccctggtgggctccgtgagcagcagcgccctggccctcatcatcccaccgctcctggag
gtcaccaccttctactcagagggcatgagccccctcaccatctttaaggacgccctgatc
agcatcctgggcttcgtgggctttgtggtggggacctatgaggctctctatgagctgatc
cagccaagcaatgctcccatcttcatcaattccacctgtgccttcatatag

DBGET integrated database retrieval system