KEGG   Homo sapiens (human): 2065Help
Entry
2065              CDS       T01001                                 

Gene name
ERBB3, ErbB-3, HER3, LCCS2, MDA-BF-1, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
Disease
H00408  Type 1 diabetes mellitus
H00865  Lethal congenital contractural syndrome
Drug target
Canertinib dihydrochloride: D03350
Istiratumab: D10943
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2065 (ERBB3)
   04012 ErbB signaling pathway
    2065 (ERBB3)
   04020 Calcium signaling pathway
    2065 (ERBB3)
   04151 PI3K-Akt signaling pathway
    2065 (ERBB3)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    2065 (ERBB3)
   05205 Proteoglycans in cancer
    2065 (ERBB3)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    2065 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2065 (ERBB3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2065 (ERBB3)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   2065 (ERBB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 2065
NCBI-ProteinID: NP_001973
OMIM: 190151
HGNC: 3431
Ensembl: ENSG00000065361
Vega: OTTHUMG00000170140
Pharos: P21860(Tchem)
UniProt: P21860
Structure
PDB: 

Position
12q13.2
AA seq 1342 aa AA seqDB search
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
RSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG
GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEED
NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPR
PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLL
TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY
EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD
SAFDNPDYWHSRLFPKANAQRT
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgaacgacgctctgcaggtgctgggcttgcttttcagcctggcccggggctcc
gaggtgggcaactctcaggcagtgtgtcctgggactctgaatggcctgagtgtgaccggc
gatgctgagaaccaataccagacactgtacaagctctacgagaggtgtgaggtggtgatg
gggaaccttgagattgtgctcacgggacacaatgccgacctctccttcctgcagtggatt
cgagaagtgacaggctatgtcctcgtggccatgaatgaattctctactctaccattgccc
aacctccgcgtggtgcgagggacccaggtctacgatgggaagtttgccatcttcgtcatg
ttgaactataacaccaactccagccacgctctgcgccagctccgcttgactcagctcacc
gagattctgtcagggggtgtttatattgagaagaacgataagctttgtcacatggacaca
attgactggagggacatcgtgagggaccgagatgctgagatagtggtgaaggacaatggc
agaagctgtcccccctgtcatgaggtttgcaaggggcgatgctggggtcctggatcagaa
gactgccagacattgaccaagaccatctgtgctcctcagtgtaatggtcactgctttggg
cccaaccccaaccagtgctgccatgatgagtgtgccgggggctgctcaggccctcaggac
acagactgctttgcctgccggcacttcaatgacagtggagcctgtgtacctcgctgtcca
cagcctcttgtctacaacaagctaactttccagctggaacccaatccccacaccaagtat
cagtatggaggagtttgtgtagccagctgtccccataactttgtggtggatcaaacatcc
tgtgtcagggcctgtcctcctgacaagatggaagtagataaaaatgggctcaagatgtgt
gagccttgtgggggactatgtcccaaagcctgtgagggaacaggctctgggagccgcttc
cagactgtggactcgagcaacattgatggatttgtgaactgcaccaagatcctgggcaac
ctggactttctgatcaccggcctcaatggagacccctggcacaagatccctgccctggac
ccagagaagctcaatgtcttccggacagtacgggagatcacaggttacctgaacatccag
tcctggccgccccacatgcacaacttcagtgttttttccaatttgacaaccattggaggc
agaagcctctacaaccggggcttctcattgttgatcatgaagaacttgaatgtcacatct
ctgggcttccgatccctgaaggaaattagtgctgggcgtatctatataagtgccaatagg
cagctctgctaccaccactctttgaactggaccaaggtgcttcgggggcctacggaagag
cgactagacatcaagcataatcggccgcgcagagactgcgtggcagagggcaaagtgtgt
gacccactgtgctcctctgggggatgctggggcccaggccctggtcagtgcttgtcctgt
cgaaattatagccgaggaggtgtctgtgtgacccactgcaactttctgaatggggagcct
cgagaatttgcccatgaggccgaatgcttctcctgccacccggaatgccaacccatggag
ggcactgccacatgcaatggctcgggctctgatacttgtgctcaatgtgcccattttcga
gatgggccccactgtgtgagcagctgcccccatggagtcctaggtgccaagggcccaatc
tacaagtacccagatgttcagaatgaatgtcggccctgccatgagaactgcacccagggg
tgtaaaggaccagagcttcaagactgtttaggacaaacactggtgctgatcggcaaaacc
catctgacaatggctttgacagtgatagcaggattggtagtgattttcatgatgctgggc
ggcacttttctctactggcgtgggcgccggattcagaataaaagggctatgaggcgatac
ttggaacggggtgagagcatagagcctctggaccccagtgagaaggctaacaaagtcttg
gccagaatcttcaaagagacagagctaaggaagcttaaagtgcttggctcgggtgtcttt
ggaactgtgcacaaaggagtgtggatccctgagggtgaatcaatcaagattccagtctgc
attaaagtcattgaggacaagagtggacggcagagttttcaagctgtgacagatcatatg
ctggccattggcagcctggaccatgcccacattgtaaggctgctgggactatgcccaggg
tcatctctgcagcttgtcactcaatatttgcctctgggttctctgctggatcatgtgaga
caacaccggggggcactggggccacagctgctgctcaactggggagtacaaattgccaag
ggaatgtactaccttgaggaacatggtatggtgcatagaaacctggctgcccgaaacgtg
ctactcaagtcacccagtcaggttcaggtggcagattttggtgtggctgacctgctgcct
cctgatgataagcagctgctatacagtgaggccaagactccaattaagtggatggccctt
gagagtatccactttgggaaatacacacaccagagtgatgtctggagctatggtgtgaca
gtttgggagttgatgaccttcggggcagagccctatgcagggctacgattggctgaagta
ccagacctgctagagaagggggagcggttggcacagccccagatctgcacaattgatgtc
tacatggtgatggtcaagtgttggatgattgatgagaacattcgcccaacctttaaagaa
ctagccaatgagttcaccaggatggcccgagacccaccacggtatctggtcataaagaga
gagagtgggcctggaatagcccctgggccagagccccatggtctgacaaacaagaagcta
gaggaagtagagctggagccagaactagacctagacctagacttggaagcagaggaggac
aacctggcaaccaccacactgggctccgccctcagcctaccagttggaacacttaatcgg
ccacgtgggagccagagccttttaagtccatcatctggatacatgcccatgaaccagggt
aatcttggggagtcttgccaggagtctgcagtttctgggagcagtgaacggtgcccccgt
ccagtctctctacacccaatgccacggggatgcctggcatcagagtcatcagaggggcat
gtaacaggctctgaggctgagctccaggagaaagtgtcaatgtgtaggagccggagcagg
agccggagcccacggccacgcggagatagcgcctaccattcccagcgccacagtctgctg
actcctgttaccccactctccccacccgggttagaggaagaggatgtcaacggttatgtc
atgccagatacacacctcaaaggtactccctcctcccgggaaggcaccctttcttcagtg
ggtctcagttctgtcctgggtactgaagaagaagatgaagatgaggagtatgaatacatg
aaccggaggagaaggcacagtccacctcatccccctaggccaagttcccttgaggagctg
ggttatgagtacatggatgtggggtcagacctcagtgcctctctgggcagcacacagagt
tgcccactccaccctgtacccatcatgcccactgcaggcacaactccagatgaagactat
gaatatatgaatcggcaacgagatggaggtggtcctgggggtgattatgcagccatgggg
gcctgcccagcatctgagcaagggtatgaagagatgagagcttttcaggggcctggacat
caggccccccatgtccattatgcccgcctaaaaactctacgtagcttagaggctacagac
tctgcctttgataaccctgattactggcatagcaggcttttccccaaggctaatgcccag
agaacgtaa

DBGET integrated database retrieval system