KEGG   Homo sapiens (human): 2066Help
Entry
2066              CDS       T01001                                 

Gene name
ERBB4, ALS19, HER4, p180erbB4
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 4
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
Drug target
Afatinib (DG00717): D09724 D09733
Canertinib dihydrochloride: D03350
Dacomitinib (DG01793): D09883 D10514
Neratinib (DG02303): D08950 D10898
Varlitinib (DG01357): D09689 D09690
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2066 (ERBB4)
   04012 ErbB signaling pathway
    2066 (ERBB4)
   04020 Calcium signaling pathway
    2066 (ERBB4)
   04151 PI3K-Akt signaling pathway
    2066 (ERBB4)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    2066 (ERBB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2066 (ERBB4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2066 (ERBB4)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   2066 (ERBB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Pkinase Furin-like Haspin_kinase APH Kinase-like DUF3951
Motif
Other DBs
NCBI-GeneID: 2066
NCBI-ProteinID: NP_005226
OMIM: 600543
HGNC: 3432
Ensembl: ENSG00000178568
Vega: OTTHUMG00000133012
Pharos: Q15303(Tclin)
UniProt: Q15303
Structure
PDB: 

Position
2q34
AA seq 1308 aa AA seqDB search
MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYD
GEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVP
YRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERS
PRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAED
EYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
NT seq 3927 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggcgacaggactttgggtctgggtgagccttctcgtggcggcggggaccgtc
cagcccagcgattctcagtcagtgtgtgcaggaacggagaataaactgagctctctctct
gacctggaacagcagtaccgagccttgcgcaagtactatgaaaactgtgaggttgtcatg
ggcaacctggagataaccagcattgagcacaaccgggacctctccttcctgcggtctgtt
cgagaagtcacaggctacgtgttagtggctcttaatcagtttcgttacctgcctctggag
aatttacgcattattcgtgggacaaaactttatgaggatcgatatgccttggcaatattt
ttaaactacagaaaagatggaaactttggacttcaagaacttggattaaagaacttgaca
gaaatcctaaatggtggagtctatgtagaccagaacaaattcctttgttatgcagacacc
attcattggcaagatattgttcggaacccatggccttccaacttgactcttgtgtcaaca
aatggtagttcaggatgtggacgttgccataagtcctgtactggccgttgctggggaccc
acagaaaatcattgccagactttgacaaggacggtgtgtgcagaacaatgtgacggcaga
tgctacggaccttacgtcagtgactgctgccatcgagaatgtgctggaggctgctcagga
cctaaggacacagactgctttgcctgcatgaatttcaatgacagtggagcatgtgttact
cagtgtccccaaacctttgtctacaatccaaccacctttcaactggagcacaatttcaat
gcaaagtacacatatggagcattctgtgtcaagaaatgtccacataactttgtggtagat
tccagttcttgtgtgcgtgcctgccctagttccaagatggaagtagaagaaaatgggatt
aaaatgtgtaaaccttgcactgacatttgcccaaaagcttgtgatggcattggcacagga
tcattgatgtcagctcagactgtggattccagtaacattgacaaattcataaactgtacc
aagatcaatgggaatttgatctttctagtcactggtattcatggggacccttacaatgca
attgaagccatagacccagagaaactgaacgtctttcggacagtcagagagataacaggt
ttcctgaacatacagtcatggccaccaaacatgactgacttcagtgttttttctaacctg
gtgaccattggtggaagagtactctatagtggcctgtccttgcttatcctcaagcaacag
ggcatcacctctctacagttccagtccctgaaggaaatcagcgcaggaaacatctatatt
actgacaacagcaacctgtgttattatcataccattaactggacaacactcttcagcaca
atcaaccagagaatagtaatccgggacaacagaaaagctgaaaattgtactgctgaagga
atggtgtgcaaccatctgtgttccagtgatggctgttggggacctgggccagaccaatgt
ctgtcgtgtcgccgcttcagtagaggaaggatctgcatagagtcttgtaacctctatgat
ggtgaatttcgggagtttgagaatggctccatctgtgtggagtgtgacccccagtgtgag
aagatggaagatggcctcctcacatgccatggaccgggtcctgacaactgtacaaagtgc
tctcattttaaagatggcccaaactgtgtggaaaaatgtccagatggcttacagggggca
aacagtttcattttcaagtatgctgatccagatcgggagtgccacccatgccatccaaac
tgcacccaagggtgtaacggtcccactagtcatgactgcatttactacccatggacgggc
cattccactttaccacaacatgctagaactcccctgattgcagctggagtaattggtggg
ctcttcattctggtcattgtgggtctgacatttgctgtttatgttagaaggaagagcatc
aaaaagaaaagagccttgagaagattcttggaaacagagttggtggaaccattaactccc
agtggcacagcacccaatcaagctcaacttcgtattttgaaagaaactgagctgaagagg
gtaaaagtccttggctcaggtgcttttggaacggtttataaaggtatttgggtacctgaa
ggagaaactgtgaagattcctgtggctattaagattcttaatgagacaactggtcccaag
gcaaatgtggagttcatggatgaagctctgatcatggcaagtatggatcatccacaccta
gtccggttgctgggtgtgtgtctgagcccaaccatccagctggttactcaacttatgccc
catggctgcctgttggagtatgtccacgagcacaaggataacattggatcacaactgctg
cttaactggtgtgtccagatagctaagggaatgatgtacctggaagaaagacgactcgtt
catcgggatttggcagcccgtaatgtcttagtgaaatctccaaaccatgtgaaaatcaca
gattttgggctagccagactcttggaaggagatgaaaaagagtacaatgctgatggagga
aagatgccaattaaatggatggctctggagtgtatacattacaggaaattcacccatcag
agtgacgtttggagctatggagttactatatgggaactgatgacctttggaggaaaaccc
tatgatggaattccaacgcgagaaatccctgatttattagagaaaggagaacgtttgcct
cagcctcccatctgcactattgacgtttacatggtcatggtcaaatgttggatgattgat
gctgacagtagacctaaatttaaggaactggctgctgagttttcaaggatggctcgagac
cctcaaagatacctagttattcagggtgatgatcgtatgaagcttcccagtccaaatgac
agcaagttctttcagaatctcttggatgaagaggatttggaagatatgatggatgctgag
gagtacttggtccctcaggctttcaacatcccacctcccatctatacttccagagcaaga
attgactcgaataggagtgaaattggacacagccctcctcctgcctacacccccatgtca
ggaaaccagtttgtataccgagatggaggttttgctgctgaacaaggagtgtctgtgccc
tacagagccccaactagcacaattccagaagctcctgtggcacagggtgctactgctgag
atttttgatgactcctgctgtaatggcaccctacgcaagccagtggcaccccatgtccaa
gaggacagtagcacccagaggtacagtgctgaccccaccgtgtttgccccagaacggagc
ccacgaggagagctggatgaggaaggttacatgactcctatgcgagacaaacccaaacaa
gaatacctgaatccagtggaggagaacccttttgtttctcggagaaaaaatggagacctt
caagcattggataatcccgaatatcacaatgcatccaatggtccacccaaggccgaggat
gagtatgtgaatgagccactgtacctcaacacctttgccaacaccttgggaaaagctgag
tacctgaagaacaacatactgtcaatgccagagaaggccaagaaagcgtttgacaaccct
gactactggaaccacagcctgccacctcggagcacccttcagcacccagactacctgcag
gagtacagcacaaaatatttttataaacagaatgggcggatccggcctattgtggcagag
aatcctgaatacctctctgagttctccctgaagccaggcactgtgctgccgcctccacct
tacagacaccggaatactgtggtgtaa

DBGET integrated database retrieval system