KEGG   Homo sapiens (human): 2067Help
Entry
2067              CDS       T01001                                 

Gene name
ERCC1, COFS4, RAD10, UV20
Definition
(RefSeq) ERCC excision repair 1, endonuclease non-catalytic subunit
  KO
K10849  DNA excision repair protein ERCC-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa03420  Nucleotide excision repair
hsa03460  Fanconi anemia pathway
Disease
H00403  Disorders of nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    2067 (ERCC1)
   03460 Fanconi anemia pathway
    2067 (ERCC1)
 Human Diseases
  Drug resistance
   01524 Platinum drug resistance
    2067 (ERCC1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     2067 (ERCC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad10 HHH_5 HHH HHH_2 FliG_N
Motif
Other DBs
NCBI-GeneID: 2067
NCBI-ProteinID: NP_001974
OMIM: 126380
HGNC: 3433
Ensembl: ENSG00000012061
Vega: OTTHUMG00000182121
Pharos: P07992(Tbio)
UniProt: P07992 A0A024R0Q6
Structure
PDB: 

Position
19q13.32
AA seq 297 aa AA seqDB search
MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTY
AEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVP
WEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQ
ALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLT
TVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggaccctgggaaggacaaagagggggtgccccagccctcagggccgccagcaaggaag
aaatttgtgatacccctcgacgaggatgaggtccctcctggagtggccaagcccttattc
cgatctacacagagccttcccactgtggacacctcggcccaggcggcccctcagacctac
gccgaatatgccatctcacagcctctggaaggggctggggccacgtgccccacagggtca
gagcccctggcaggagagacgcccaaccaggccctgaaacccggggcaaaatccaacagc
atcattgtgagccctcggcagaggggcaatcccgtactgaagttcgtgcgcaatgtgccc
tgggaatttggcgacgtaattcccgactatgtgctgggccagagcacctgtgccctgttc
ctcagcctccgctaccacaacctgcacccagactacatccatgggcggctgcagagcctg
gggaagaacttcgccttgcgggtcctgcttgtccaggtggatgtgaaagatccccagcag
gccctcaaggagctggctaagatgtgtatcctggccgactgcacattgatcctcgcctgg
agccccgaggaagctgggcggtacctggagacctacaaggcctatgagcagaaaccagcg
gacctcctgatggagaagctagagcaggacttcgtctcccgggtgactgaatgtctgacc
accgtgaagtcagtcaacaaaacggacagtcagaccctcctgaccacatttggatctctg
gaacagctcatcgccgcatcaagagaagatctggccttatgcccaggcctgggccctcag
aaagcccggaggctgtttgatgtcctgcacgagcccttcttgaaagtaccctga

DBGET integrated database retrieval system