KEGG   Homo sapiens (human): 2067
Entry
2067              CDS       T01001                                 
Symbol
ERCC1, COFS4, RAD10, UV20
Name
(RefSeq) ERCC excision repair 1, endonuclease non-catalytic subunit
  KO
K10849  DNA excision repair protein ERCC-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa03420  Nucleotide excision repair
hsa03460  Fanconi anemia pathway
Network
nt06502  Nucleotide excision repair
nt06508  Interstrand crosslink repair
  Element
N01431  Core NER reaction
N01465  Lesion bypass by TLS and DSB formation
Disease
H00403  Disorders of nucleotide excision repair
H02570  Cerebro-oculo-facio-skeletal syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    2067 (ERCC1)
   03460 Fanconi anemia pathway
    2067 (ERCC1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2067 (ERCC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2067 (ERCC1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     2067 (ERCC1)
SSDB
Motif
Pfam: Rad10 HHH_5 HHH HHH_2 FliG_N
Other DBs
NCBI-GeneID: 2067
NCBI-ProteinID: NP_001974
OMIM: 126380
HGNC: 3433
Ensembl: ENSG00000012061
Pharos: P07992(Tbio)
UniProt: P07992 A0A024R0Q6
Structure
Position
19:complement(45407334..45451547)
AA seq 297 aa
MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTY
AEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVP
WEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQ
ALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLT
TVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaccctgggaaggacaaagagggggtgccccagccctcagggccgccagcaaggaag
aaatttgtgatacccctcgacgaggatgaggtccctcctggagtggccaagcccttattc
cgatctacacagagccttcccactgtggacacctcggcccaggcggcccctcagacctac
gccgaatatgccatctcacagcctctggaaggggctggggccacgtgccccacagggtca
gagcccctggcaggagagacgcccaaccaggccctgaaacccggggcaaaatccaacagc
atcattgtgagccctcggcagaggggcaatcccgtactgaagttcgtgcgcaatgtgccc
tgggaatttggcgacgtaattcccgactatgtgctgggccagagcacctgtgccctgttc
ctcagcctccgctaccacaacctgcacccagactacatccatgggcggctgcagagcctg
gggaagaacttcgccttgcgggtcctgcttgtccaggtggatgtgaaagatccccagcag
gccctcaaggagctggctaagatgtgtatcctggccgactgcacattgatcctcgcctgg
agccccgaggaagctgggcggtacctggagacctacaaggcctatgagcagaaaccagcg
gacctcctgatggagaagctagagcaggacttcgtctcccgggtgactgaatgtctgacc
accgtgaagtcagtcaacaaaacggacagtcagaccctcctgaccacatttggatctctg
gaacagctcatcgccgcatcaagagaagatctggccttatgcccaggcctgggccctcag
aaagcccggaggctgtttgatgtcctgcacgagcccttcttgaaagtaccctga

DBGET integrated database retrieval system