KEGG   Homo sapiens (human): 2069Help
Entry
2069              CDS       T01001                                 

Gene name
EREG, EPR, ER, Ep
Definition
(RefSeq) epiregulin
  KO
K09784  epiregulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05210  Colorectal cancer
Network
N00277  EREG-EGFR-RAS-ERK signaling pathway
N00278  EREG-overexpression to RAS-ERK signaling pathway
N00282  EREG-EGFR-PI3K signaling pathway
N00283  EREG-overexpression to PI3K signaling pathway
Disease
H00020  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2069 (EREG)
   04012 ErbB signaling pathway
    2069 (EREG)
   04151 PI3K-Akt signaling pathway
    2069 (EREG)
 09160 Human Diseases
  09162 Cancers: Specific types
   05210 Colorectal cancer
    2069 (EREG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF BCCT CD34_antigen DUF2207
Motif
Other DBs
NCBI-GeneID: 2069
NCBI-ProteinID: NP_001423
OMIM: 602061
HGNC: 3443
Ensembl: ENSG00000124882
Vega: OTTHUMG00000130005
Pharos: O14944(Tbio)
UniProt: O14944
Structure
PDB: 

Position
4q13.3
AA seq 169 aa AA seqDB search
MTAGRRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRV
AQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVA
LTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggggaggaggatggagatgctctgtgccggcagggtccctgcgctgctgctc
tgcctgggtttccatcttctacaggcagtcctcagtacaactgtgattccatcatgtatc
ccaggagagtccagtgataactgcacagctttagttcagacagaagacaatccacgtgtg
gctcaagtgtcaataacaaagtgtagctctgacatgaatggctattgtttgcatggacag
tgcatctatctggtggacatgagtcaaaactactgcaggtgtgaagtgggttatactggt
gtccgatgtgaacacttctttttaaccgtccaccaacctttaagcaaagaatatgtggct
ttgaccgtgattcttattattttgtttcttatcacagtcgtcggttccacatattatttc
tgcagatggtacagaaatcgaaaaagtaaagaaccaaagaaggaatatgagagagttacc
tcaggggatccagagttgccgcaagtctga

DBGET integrated database retrieval system