KEGG   Homo sapiens (human): 2072Help
Entry
2072              CDS       T01001                                 

Gene name
ERCC4, ERCC11, FANCQ, RAD1, XFEPS, XPF
Definition
(RefSeq) ERCC excision repair 4, endonuclease catalytic subunit
  KO
K10848  DNA excision repair protein ERCC-4 [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa03460  Fanconi anemia pathway
Disease
H00238  Fanconi anemia
H00403  Disorders of nucleotide excision repair
H01428  Xeroderma pigmentosum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    2072 (ERCC4)
   03460 Fanconi anemia pathway
    2072 (ERCC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    2072 (ERCC4)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2072 (ERCC4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     2072 (ERCC4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     2072 (ERCC4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     2072 (ERCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERCC4 HHH_5
Motif
Other DBs
NCBI-GeneID: 2072
NCBI-ProteinID: NP_005227
OMIM: 133520
HGNC: 3436
Ensembl: ENSG00000175595
Vega: OTTHUMG00000048194
Pharos: Q92889(Tbio)
UniProt: Q92889 A0A1W1GSK9
Structure
PDB: 

Position
16p13.12
AA seq 916 aa AA seqDB search
MESGQPARRIAMAPLLEYERQLVLELLDTDGLVVCARGLGADRLLYHFLQLHCHPACLVL
VLNTQPAEEEYFINQLKIEGVEHLPRRVTNEITSNSRYEVYTQGGVIFATSRILVVDFLT
DRIPSDLITGILVYRAHRIIESCQEAFILRLFRQKNKRGFIKAFTDNAVAFDTGFCHVER
VMRNLFVRKLYLWPRFHVAVNSFLEQHKPEVVEIHVSMTPTMLAIQTAILDILNACLKEL
KCHNPSLEVEDLSLENAIGKPFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQ
YDCVTFLNLLESLRATEKAFGQNSGWLFLDSSTSMFINARARVYHLPDAKMSKKEKISEK
MEIKEGEETKKELVLESNPKWEALTEVLKEIEAENKESEALGGPGQVLICASDDRTCSQL
RDYITLGAEAFLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST
KERTLKKKKRKLTLTQMVGKPEELEEEGDVEEGYRREISSSPESCPEEIKHEEFDVNLSS
DAAFGILKEPLTIIHPLLGCSDPYALTRVLHEVEPRYVVLYDAELTFVRQLEIYRASRPG
KPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRDETNLDLVRGT
ASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTP
EMCVERKSISDLIGSLNNGRLYSQCISMSRYYKRPVLLIEFDPSKPFSLTSRGALFQEIS
SNDISSKLTLLTLHFPRLRILWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPE
SEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDF
IHTSFAEVVSKGKGKK
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagggcagccggctcgacggattgccatggcgccgctgctggagtacgagcga
cagctggtgctggaactgctcgacactgacgggctagtagtgtgcgcccgcgggctcggc
gcggaccggctcctctaccactttctccagctgcactgccacccagcctgcctggtgctg
gtgctcaacacgcagccggccgaggaggagtattttatcaatcagctgaagatagaagga
gttgaacacctccctcgccgtgtaacaaatgaaatcacaagcaacagtcgctatgaagtt
tacacacaaggtggtgttatatttgcgacaagtaggatacttgtggttgacttcttgact
gatagaataccttcagatttaattactggcatcttggtgtatagagcccacagaataatc
gagtcttgtcaagaagcattcatcttgcgcctctttcgccagaaaaacaaacgtggtttt
attaaagctttcacagacaatgctgttgcctttgatactggtttttgtcatgtggaaaga
gtgatgagaaatctttttgtgaggaaactgtatctgtggccaaggttccatgtagcagta
aactcatttttagaacagcacaaacctgaagttgtagaaatccatgtttctatgacacct
accatgcttgctatacagactgctatactggacattttaaatgcatgtctaaaggaacta
aaatgccataacccatcgcttgaagtggaagatttatctttagaaaatgctattggaaaa
ccttttgacaagacaatccgccattatctggatcctttgtggcaccagcttggagccaag
actaaatccttagttcaggatttgaagatattacgaactttgctgcagtatctctctcag
tatgattgtgtcacatttcttaatcttctggaatctctgagagcaacggaaaaagctttt
ggtcagaattcaggttggctgtttcttgactccagcacctcgatgtttataaatgctcga
gcaagggtttatcatcttccagatgccaaaatgagtaaaaaagaaaaaatatctgaaaaa
atggaaattaaagaaggggaagaaacaaaaaaggaactggtcctagaaagcaacccaaag
tgggaggcactgactgaagtattaaaagaaattgaggcagaaaataaggagagtgaagct
cttggtggtccaggtcaagtactgatttgtgcaagtgatgaccgaacatgttcccagctg
agagactatatcactcttggagcggaggccttcttattgaggctctacaggaaaaccttt
gagaaggatagcaaagctgaagaagtctggatgaaatttaggaaggaagacagttcaaag
agaattaggaaatctcacaaaagacctaaagacccccaaaacaaagaacgggcttctacc
aaagaaagaaccctcaaaaagaaaaaacggaagttgaccttaactcaaatggtaggaaaa
cctgaagaactggaagaggaaggagatgtcgaggaaggatatcgtcgagaaataagcagt
agcccagaaagctgcccggaagaaattaagcatgaagaatttgatgtaaatttgtcatcg
gatgctgctttcggaatcctgaaagaacccctcactatcatccatccgcttctgggttgc
agcgacccctatgctctgacaagggtactacatgaagtggagccaagatacgtggttctt
tatgacgcagagctaacctttgttcggcagcttgaaatttacagggcgagtaggcctggg
aaacctctgagggtttactttcttatatacggaggttcaactgaggaacaacgctatctc
actgctttgcggaaagaaaaggaagcttttgaaaaactcataagggaaaaagcaagcatg
gttgtccctgaagaaagagaaggcagagatgaaacaaacttagacctagtaagaggcaca
gcatctgcagatgtttccactgacactcggaaagccggtggccaggaacagaatggtaca
cagcaaagcatagttgtggatatgcgtgaatttcgaagtgagcttccatctctgatccat
cgtcggggcattgacattgaacccgtgactttagaggttggagattacatcctcactcca
gaaatgtgcgtggagcgcaagagtatcagtgatttaatcggctctttaaataacggccgc
ctctacagccagtgcatctccatgtcccgctactacaagcgtcccgtgcttctgattgag
tttgaccctagcaagcctttctctctcacttcccgaggtgccttgtttcaggagatctcc
agcaatgacattagttccaaactcactcttcttacacttcacttccccagactacggatt
ctctggtgcccctctcctcatgcaacggcggagttgtttgaggagctgaaacaaagcaag
ccacagcctgatgcggcgacagcactggccattacagcagattctgaaacccttcccgag
tcagagaagtataatcctggtccccaagacttcttgttaaaaatgccaggggtgaatgcc
aaaaactgccgctccttgatgcaccacgttaagaacatcgcagaattagcagccctgtca
caagacgagctcacgagtattctggggaatgctgcaaatgccaaacagctttatgatttc
attcacacctcttttgcagaagtcgtatcaaaaggaaaagggaaaaagtga

DBGET integrated database retrieval system